BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_I17 (895 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GP... 23 3.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 23 5.0 >DQ201783-1|ABB05503.1| 381|Apis mellifera capa receptor-like GPCR protein. Length = 381 Score = 23.0 bits (47), Expect = 3.8 Identities = 10/26 (38%), Positives = 16/26 (61%) Frame = -1 Query: 268 MVTASTISFLLIFEPGRSGSLTTWVI 191 MV TI +++IF G G++TT + Sbjct: 39 MVIPLTIIYMIIFVTGIFGNITTCTV 64 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 22.6 bits (46), Expect = 5.0 Identities = 12/40 (30%), Positives = 18/40 (45%) Frame = -1 Query: 760 YGVAXLXANEK*HLVSLPLVTPMQSIISXWPNTESTGIGF 641 Y + L +NE + P V+ Q + +P ST GF Sbjct: 345 YSQSHLISNENRDFQTTPTVSVEQPHLFLYPEVSSTYTGF 384 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,203 Number of Sequences: 438 Number of extensions: 3500 Number of successful extensions: 6 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 28904421 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -