BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_I15 (848 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 24 1.5 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 24 2.0 AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 23 2.7 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 23 2.7 L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein pro... 22 6.2 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 22 8.2 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 22 8.2 AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. 22 8.2 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 24.2 bits (50), Expect = 1.5 Identities = 13/40 (32%), Positives = 17/40 (42%) Frame = +2 Query: 239 LQYRAHGKKHNDAQSHQRPPGQQSSPRETVATHQGQRWLR 358 LQ H + Q H RP QQ ++ Q +R LR Sbjct: 144 LQNHHHHLQSTAVQDHHRPYQQQQQQQQRQQQRQEERRLR 183 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 23.8 bits (49), Expect = 2.0 Identities = 11/41 (26%), Positives = 18/41 (43%) Frame = -2 Query: 571 MCTSLMISIVPFEILVGIERAWKKEVFSGPRPVLWAGMTTD 449 +C ++ + + L WK GP+PV + G T D Sbjct: 8 LCGIAVLFLALYYYLTSTFDFWKSRGVVGPKPVPFFGTTKD 48 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 23.4 bits (48), Expect = 2.7 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 590 GWSF*SHPSQHVEHLSILIWSCLLSRYMILELFLHLKFWT 709 G +F +PS +E IWSCL +M++ + L +F T Sbjct: 357 GLAFLVYPSAVLELPGSSIWSCLFF-FMLILIGLDSQFCT 395 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 23.4 bits (48), Expect = 2.7 Identities = 14/40 (35%), Positives = 22/40 (55%) Frame = +2 Query: 590 GWSF*SHPSQHVEHLSILIWSCLLSRYMILELFLHLKFWT 709 G +F +PS +E IWSCL +M++ + L +F T Sbjct: 410 GLAFLVYPSAVLELPGSSIWSCLFF-FMLILIGLDSQFCT 448 >L01589-1|AAA27736.1| 81|Apis mellifera zinc finger protein protein. Length = 81 Score = 22.2 bits (45), Expect = 6.2 Identities = 10/22 (45%), Positives = 13/22 (59%) Frame = -2 Query: 367 RVNTKPTLPLMCGNSFSRAGLL 302 R +T P +CG +FSR LL Sbjct: 37 RTHTLPCKCHLCGKAFSRPWLL 58 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.8 bits (44), Expect = 8.2 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 334 CGNSFSRAGLLSRWSLMALRIIVFF-PMSTIL 242 CG + GLLS L+ I V+F P+ I+ Sbjct: 202 CGTDYFNRGLLSASYLVCYGIWVYFVPLFLII 233 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 21.8 bits (44), Expect = 8.2 Identities = 12/32 (37%), Positives = 17/32 (53%), Gaps = 1/32 (3%) Frame = -2 Query: 334 CGNSFSRAGLLSRWSLMALRIIVFF-PMSTIL 242 CG + GLLS L+ I V+F P+ I+ Sbjct: 78 CGTDYFNRGLLSASYLVCYGIWVYFVPLFLII 109 >AB167961-1|BAD51404.1| 554|Apis mellifera E74 protein. Length = 554 Score = 21.8 bits (44), Expect = 8.2 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 500 FLPGSFYPYQDFKGYY*NHQ 559 FLP S++P+Q Y H+ Sbjct: 311 FLPPSYHPHQHHPSQYHPHR 330 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 249,264 Number of Sequences: 438 Number of extensions: 5639 Number of successful extensions: 16 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27309825 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -