BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_I08 (853 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 25 1.0 AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory recept... 24 1.3 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 24.6 bits (51), Expect = 1.0 Identities = 9/22 (40%), Positives = 15/22 (68%) Frame = +2 Query: 701 PLEIPSGYSITILQDSRRSAWF 766 P+EIP Y+ + L++ R A+F Sbjct: 176 PIEIPRDYTASDLEEEHRLAYF 197 >AM292359-1|CAL23171.2| 436|Tribolium castaneum gustatory receptor candidate 38 protein. Length = 436 Score = 24.2 bits (50), Expect = 1.3 Identities = 16/52 (30%), Positives = 27/52 (51%), Gaps = 2/52 (3%) Frame = +3 Query: 576 RLYPMLCSRSKLSL--RNKVTLYKTCIRPVMTYASVVFAHAARTHLKSLQVI 725 R+Y L ++ KLS+ NK + T + P++ +V H H K +QV+ Sbjct: 167 RIYYKL-TKKKLSVFFGNKPVIL-TVVLPLLACGVMVVTHITMAHFKIIQVV 216 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 195,990 Number of Sequences: 336 Number of extensions: 4403 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23555563 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -