BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_I06 (931 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_30491| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.4 SB_30129| Best HMM Match : Y_phosphatase (HMM E-Value=6.7e-13) 29 7.1 >SB_30491| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1516 Score = 29.1 bits (62), Expect = 5.4 Identities = 11/35 (31%), Positives = 21/35 (60%) Frame = -1 Query: 241 LTNVSMSQMQGQVDYDFGVGGRLPIVRCEERVDHE 137 L+++S +G VD FGV + +R +++D+E Sbjct: 594 LSHISGGDKEGDVDLHFGVNSQTGAIRLNKKLDYE 628 >SB_30129| Best HMM Match : Y_phosphatase (HMM E-Value=6.7e-13) Length = 139 Score = 28.7 bits (61), Expect = 7.1 Identities = 17/47 (36%), Positives = 22/47 (46%), Gaps = 1/47 (2%) Frame = -1 Query: 256 PVDLGLTNVSMSQMQGQVDYDFGVGGRLP-IVRCEERVDHEGQ*CCV 119 P++ GL+ + + GQV Y GR P IV C V G C V Sbjct: 60 PLEDGLSRCQLIDLIGQVQYWQAESGRHPIIVHCSAGVGRTGVFCAV 106 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,643,672 Number of Sequences: 59808 Number of extensions: 277831 Number of successful extensions: 721 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 591 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 681 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2705204627 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -