BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_I05 (899 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_1291 + 25930056-25930067,25930289-25930334,25930434-259305... 29 3.8 12_01_0843 + 7891622-7892524 29 6.7 07_03_0809 - 21669632-21669637,21669871-21670131,21670573-216707... 28 8.8 02_01_0296 + 1978565-1981197,1981216-1981639,1982280-1982771,198... 28 8.8 >08_02_1291 + 25930056-25930067,25930289-25930334,25930434-25930546, 25930645-25930930,25931357-25931421,25931642-25931693, 25931774-25931883,25932611-25932641,25932853-25933004, 25934622-25934840 Length = 361 Score = 29.5 bits (63), Expect = 3.8 Identities = 12/30 (40%), Positives = 17/30 (56%) Frame = -1 Query: 224 HGGLGLTNVSMSQMQGQVDYDFGVGGRLPI 135 +GG L ++Q G Y +G GGRLP+ Sbjct: 100 YGGPALPRYGIAQFPGGSGYPYGYGGRLPM 129 >12_01_0843 + 7891622-7892524 Length = 300 Score = 28.7 bits (61), Expect = 6.7 Identities = 24/81 (29%), Positives = 34/81 (41%), Gaps = 1/81 (1%) Frame = +3 Query: 285 EWGCSTWLVSS-ERLWRPDVVLLNAAATTAGDYALRARVSNNGSVSWISAWTLALQFLCS 461 +WG TW ++ R PD AAA AL AR + + + + AW F C Sbjct: 200 QWGRVTWKNAAFHRAVAPD-----AAAPDQARVALAAR--DGDAAAAVPAWGTCAGFTCR 252 Query: 462 *TIGPTTCRLARSSSVLGCTI 524 + P+ RSS V C + Sbjct: 253 VRVHPSPYSPRRSSVVAPCDV 273 >07_03_0809 - 21669632-21669637,21669871-21670131,21670573-21670752, 21671458-21672819 Length = 602 Score = 28.3 bits (60), Expect = 8.8 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +3 Query: 96 SLSLMIDSLLATYDRESPPDSKIVVNLTLHLRHANIRESESTVRILADLQMN 251 +L +D L+ YD+ PPDS+ V HA + +R+L + +N Sbjct: 160 NLWTQVDILILRYDK--PPDSRFVQEALAAHAHATEGSETTAIRLLEVISLN 209 >02_01_0296 + 1978565-1981197,1981216-1981639,1982280-1982771, 1982950-1983087 Length = 1228 Score = 28.3 bits (60), Expect = 8.8 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 393 GRGERSPRRWLQPRLAVPRQASTSVPRTP 307 GRG RS R L+P LA+ A + +P P Sbjct: 442 GRGPRSTLRILRPGLAISEMARSMLPAEP 470 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 20,041,994 Number of Sequences: 37544 Number of extensions: 445005 Number of successful extensions: 1209 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 1172 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1209 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2542098580 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -