BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H24 (905 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/n... 28 0.34 AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleo... 28 0.34 AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform ... 25 2.4 AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform ... 25 2.4 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 24 5.5 AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant r... 24 5.5 AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein hom... 24 7.3 AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcript... 23 9.6 >AJ441131-3|CAD29632.1| 568|Anopheles gambiae putative apyrase/nucleotidase protein. Length = 568 Score = 28.3 bits (60), Expect = 0.34 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 303 VTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKIPVTVD 428 + + LP+V ++ G+ +L N A FP P P+ V+ Sbjct: 247 IIARELPDVDVVVGGHSHTFLYNGTADGFPDDPEDTYPIVVE 288 >AJ439398-2|CAD28125.1| 568|Anopheles gambiae putative 5' nucleotidase protein. Length = 568 Score = 28.3 bits (60), Expect = 0.34 Identities = 12/42 (28%), Positives = 21/42 (50%) Frame = +3 Query: 303 VTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKIPVTVD 428 + + LP+V ++ G+ +L N A FP P P+ V+ Sbjct: 247 IIARELPDVDVVVGGHSHTFLYNGTADGFPDDPEDTYPIVVE 288 >AY943929-1|AAX49502.1| 755|Anopheles gambiae laccase-2 isoform B protein. Length = 755 Score = 25.4 bits (53), Expect = 2.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 297 SIWFRCQ*DRSTGVEKG*PNVEETVPG 217 ++W CQ + GVE+G V +PG Sbjct: 190 TVWSHCQCVLADGVERGILTVNRMIPG 216 >AY943928-1|AAX49501.1| 753|Anopheles gambiae laccase-2 isoform A protein. Length = 753 Score = 25.4 bits (53), Expect = 2.4 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = -3 Query: 297 SIWFRCQ*DRSTGVEKG*PNVEETVPG 217 ++W CQ + GVE+G V +PG Sbjct: 190 TVWSHCQCVLADGVERGILTVNRMIPG 216 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 24.2 bits (50), Expect = 5.5 Identities = 15/40 (37%), Positives = 21/40 (52%), Gaps = 2/40 (5%) Frame = +3 Query: 546 DLGYINPI--IKIPDSIHQPPQTLTSXSINPLXAVLKXVR 659 D G I PI ++PD+I P TS + L +LK +R Sbjct: 439 DDGSIGPIGTNRMPDAIAPPHTCFTSSADYELALILKEIR 478 >AF364131-1|AAL35507.1| 378|Anopheles gambiae putative odorant receptor Or2 protein. Length = 378 Score = 24.2 bits (50), Expect = 5.5 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 369 NLEAVVFPSAPSLKIPVTVDLCWTTADVTVEGVNVLATPS 488 NL F SA + P+ V VT+ GV+VLATP+ Sbjct: 123 NLWLGAFISACFVTYPLFVPGRGLPYGVTIPGVDVLATPT 162 >AF119382-1|AAD27585.1| 394|Anopheles gambiae caudal protein homolog protein. Length = 394 Score = 23.8 bits (49), Expect = 7.3 Identities = 12/33 (36%), Positives = 14/33 (42%) Frame = +1 Query: 529 KPPSPAISATSTRSSKSPIPYTNHPRL*HPXPS 627 +PP P SS P Y HP + HP S Sbjct: 35 QPPHPQFIGDG-ESSPQPAMYYPHPHVFHPQSS 66 >AB090815-2|BAC57906.1| 973|Anopheles gambiae reverse transcriptase protein. Length = 973 Score = 23.4 bits (48), Expect = 9.6 Identities = 13/41 (31%), Positives = 19/41 (46%), Gaps = 2/41 (4%) Frame = +2 Query: 242 GHPFSTPVLRSYWHRNQIEQC--HCAITTERLLHHKRLPRR 358 G P+ P R+YW +I QC HC ++ K +R Sbjct: 263 GGPY--PRRRAYWWTTEIAQCRSHCIEARRKMNRAKSSEQR 301 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 786,243 Number of Sequences: 2352 Number of extensions: 15792 Number of successful extensions: 32 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 97987887 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -