BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H20 (851 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein... 25 0.88 AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein... 25 0.88 DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. 22 8.2 AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly pro... 22 8.2 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 8.2 >AY273778-1|AAP33487.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.0 bits (52), Expect = 0.88 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 665 TTSQRWSRGSTPRSLSTSRANNHHIKP 585 T +Q WSRG+T SL S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >AF263459-1|AAF73057.1| 427|Apis mellifera ultraspiracle protein protein. Length = 427 Score = 25.0 bits (52), Expect = 0.88 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -1 Query: 665 TTSQRWSRGSTPRSLSTSRANNHHIKP 585 T +Q WSRG+T SL S + + P Sbjct: 18 TQAQHWSRGNTWLSLDNSNMSMSSVGP 44 >DQ257416-1|ABB81847.1| 552|Apis mellifera yellow-h protein. Length = 552 Score = 21.8 bits (44), Expect = 8.2 Identities = 9/20 (45%), Positives = 12/20 (60%) Frame = -3 Query: 273 GYDSTSSLNKFFPGTTQVDH 214 G TS+L+ FP +VDH Sbjct: 472 GVIGTSNLSLVFPNDIKVDH 491 >AY398690-1|AAR83734.1| 416|Apis mellifera major royal jelly protein 8 protein. Length = 416 Score = 21.8 bits (44), Expect = 8.2 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 2/67 (2%) Frame = +1 Query: 19 FASQWHYTRLVVTQISATMSGGLDVLALNEEDVTKMLAATTHLGAENVNF-QMETYVYKR 195 FAS YT + S T+ G+ +AL+ +T+ L + L + N+N+ E +V + Sbjct: 229 FASDPRYTTFTINGESFTLQSGIFGMALS--PLTQNLYYSA-LSSHNLNYVNTEQFVKSQ 285 Query: 196 -RADGTH 213 +A+ H Sbjct: 286 YQANNVH 292 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 21.8 bits (44), Expect = 8.2 Identities = 6/30 (20%), Positives = 16/30 (53%) Frame = +1 Query: 442 VLDPAQDHQPITEASYVNIPVIALCNTDSP 531 ++DP ++++ E + IP++ + P Sbjct: 167 IVDPVEENETYDEFDTIRIPIVRSLSKSPP 196 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 228,389 Number of Sequences: 438 Number of extensions: 5172 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27431202 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -