BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H18 (906 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8) 33 0.42 SB_27881| Best HMM Match : Keratin_B2 (HMM E-Value=0.5) 32 0.73 SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) 32 0.73 SB_27756| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.73 SB_38269| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_25387| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.2 SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) 29 3.9 SB_59599| Best HMM Match : rve (HMM E-Value=1.69557e-43) 29 5.2 SB_30122| Best HMM Match : YadA (HMM E-Value=2) 29 5.2 SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) 29 5.2 SB_23155| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.2 SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) 29 5.2 SB_48885| Best HMM Match : DUF741 (HMM E-Value=0.88) 29 6.8 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.8 SB_27194| Best HMM Match : C2 (HMM E-Value=1e-22) 28 9.0 SB_20390| Best HMM Match : LRR_1 (HMM E-Value=0.34) 28 9.0 SB_15184| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.0 SB_31263| Best HMM Match : TP2 (HMM E-Value=5.5) 28 9.0 SB_17488| Best HMM Match : Phi-29_GP3 (HMM E-Value=0.69) 28 9.0 >SB_5400| Best HMM Match : DUF1153 (HMM E-Value=7.8) Length = 170 Score = 32.7 bits (71), Expect = 0.42 Identities = 19/46 (41%), Positives = 21/46 (45%), Gaps = 2/46 (4%) Frame = +3 Query: 513 SRPYASSHPPL-RSRLHQPDHQIP-DSIHQPPQT*HPFPSIPWTPY 644 S P S P L R RL P IH PPQ HP +PW P+ Sbjct: 125 STPRPSHIPRLKRRRLQTPTKTTTLPPIHSPPQDQHPGRQLPWDPF 170 >SB_27881| Best HMM Match : Keratin_B2 (HMM E-Value=0.5) Length = 168 Score = 31.9 bits (69), Expect = 0.73 Identities = 21/63 (33%), Positives = 29/63 (46%), Gaps = 3/63 (4%) Frame = +3 Query: 462 RSQCAGHPFILSHYYWRSRPYASSHPPLRSRLHQP---DHQIPDSIHQPPQT*HPFPSIP 632 +S C HP Y +P SHP R +QP +H I ++QP HP +IP Sbjct: 31 QSSCINHPVSTILY----QPSCISHPVSTIR-YQPSRINHPISTILYQPSHINHPVSTIP 85 Query: 633 WTP 641 + P Sbjct: 86 YQP 88 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/60 (30%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +3 Query: 471 CAGHPFILSHYYWRSRPYASSHPPLRSRLHQP---DHQIPDSIHQPPQT*HPFPSIPWTP 641 C HP Y +P +HP + + L+QP +H + ++QP HP +IP+ P Sbjct: 90 CINHPVSTIMY----QPPCINHP-VSTTLYQPSCINHPVSTILYQPSCINHPVSTIPYQP 144 >SB_20462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.9 bits (69), Expect = 0.73 Identities = 18/44 (40%), Positives = 20/44 (45%), Gaps = 2/44 (4%) Frame = +3 Query: 519 PYASSHPPL-RSRLHQPDHQIP-DSIHQPPQT*HPFPSIPWTPY 644 P S P L R RL P IH PPQ HP +PW P+ Sbjct: 87 PRPSRIPRLKRRRLQTPTRTTTLPPIHSPPQDQHPGRQLPWDPF 130 >SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) Length = 458 Score = 31.9 bits (69), Expect = 0.73 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +3 Query: 414 TSHS*PLLDYC*RHS*RSQCAGHPFILSHYYWRSRPY--ASSHPPLR 548 T + LL YC R AGHPF+L Y + R Y +S PLR Sbjct: 91 TKYDIDLLGYCTEQEIRRVVAGHPFLLDGYKFDLRVYVLVTSCDPLR 137 >SB_27756| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 520 Score = 31.9 bits (69), Expect = 0.73 Identities = 29/94 (30%), Positives = 41/94 (43%), Gaps = 5/94 (5%) Frame = +3 Query: 519 PYASSHPPLRSRLHQPDH---QIPDSIHQPPQT*HPFPSIPWTPY*KGVRAG--GLKPPV 683 PY S PP +S +QP H Q P +QPP + P + P K + +PP Sbjct: 422 PYKSYQPPHKS--YQPPHKSYQPPHKSYQPPHKSYQPPHKSYQPPHKSYQPPHKSYQPPY 479 Query: 684 VIRGSISVSHPPRSLGMAKXGFRPLYFQVNDEIT 785 S P +S ++PL+ Q ND+IT Sbjct: 480 K-----SYQPPYKSYQPPYKSYQPLHQQRNDQIT 508 >SB_38269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 732 Score = 30.3 bits (65), Expect = 2.2 Identities = 20/74 (27%), Positives = 27/74 (36%) Frame = +2 Query: 530 KPPSPAISATSTRSSNPRFHTPTTPDLTSISINPLDAVLKRSSRRGFKASGCHQRLHQRI 709 +P S A ST S + FH T P L S ++SG +R QR+ Sbjct: 621 RPSSARARANSTDSDDSVFHESANQSETGADTRPRTRTLSGRSAASTESSGLLKRTLQRV 680 Query: 710 SPPSFTGHG*XGXP 751 + H G P Sbjct: 681 ASADQKVHSATGSP 694 >SB_25387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 30.3 bits (65), Expect = 2.2 Identities = 16/47 (34%), Positives = 25/47 (53%), Gaps = 6/47 (12%) Frame = +3 Query: 474 AGHPFILSHYYWRSRPYASSH------PPLRSRLHQPDHQIPDSIHQ 596 + HP + H+ +S P+ SSH PP + LH+PD+ + HQ Sbjct: 289 SAHPSQVPHH--KSEPHTSSHKPQLWVPPTQQSLHKPDNPHKNPYHQ 333 >SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) Length = 474 Score = 29.5 bits (63), Expect = 3.9 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -1 Query: 456 CDVSSSPTKVNCDWYFEARGGRKNDSLKIDKIRVAVAFYDGGDVR**LHSDTVRFGFGAS 277 C + P + W+F + G K DS + + + G V +HS VR G GA+ Sbjct: 275 CVRAHLPNAADQPWFFLSNTGAKIDSNNVQSLLRSFQRSTGVQVSKPIHSTAVRCGSGAT 334 Query: 276 KIE 268 + E Sbjct: 335 EEE 337 >SB_59599| Best HMM Match : rve (HMM E-Value=1.69557e-43) Length = 1803 Score = 29.1 bits (62), Expect = 5.2 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 8/66 (12%) Frame = -1 Query: 591 VWNRGFDDRVDVAEIAGEG----GLMHKGE-TANSNARG*RGGQHIDSFNCD---VSSSP 436 +W++ +DVAE+AG G GL + TA S G HID F C +S P Sbjct: 1545 LWHKDTAGHIDVAEVAGGGATNEGLKKRAAYTAQSVEVGLIVNLHIDIFKCGRYLLSGVP 1604 Query: 435 TKVNCD 418 K+ + Sbjct: 1605 MKIRLE 1610 >SB_30122| Best HMM Match : YadA (HMM E-Value=2) Length = 408 Score = 29.1 bits (62), Expect = 5.2 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +1 Query: 394 SAPSLKIPVTVDLCWTTADVTVEGVNVLATPSSSRIT 504 S P K+P+T T+A+VT +++ +PS + +T Sbjct: 239 SRPETKVPITTIGASTSAEVTTSQRDLMPSPSQAHVT 275 >SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 1433 Score = 29.1 bits (62), Expect = 5.2 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = +1 Query: 268 FDLTGTETKSNSVTVQS---LPNVSSIIKGYRDAYLVNL 375 F +TG E KS+S+T++ +P V ++ +G D +LV+L Sbjct: 485 FTITGQEGKSDSITIRHADVIPRV-ALARGNEDVFLVHL 522 >SB_23155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 29.1 bits (62), Expect = 5.2 Identities = 17/48 (35%), Positives = 22/48 (45%), Gaps = 3/48 (6%) Frame = +3 Query: 510 RSRPYASSHPPLRSRLHQP---DHQIPDSIHQPPQT*HPFPSIPWTPY 644 R P S P +R + D +PD I PPQ HP + PW P+ Sbjct: 121 RRLPMTSDKTPKSTRKEKHVNWDPFLPD-IKSPPQDQHPGKTTPWEPF 167 >SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) Length = 808 Score = 29.1 bits (62), Expect = 5.2 Identities = 30/112 (26%), Positives = 43/112 (38%), Gaps = 5/112 (4%) Frame = +1 Query: 292 KSNSVTVQSLPNVS--SIIKGYRDAYLVNLEAVVFPSAPSLKIPVTVDLCWTTADVTVEG 465 +++ VT Q P+ S + GY D N+ PS S I V ++ W T Sbjct: 207 EAHIVTEQEAPSCSPEDLAVGYSDGKAHNITWSPIPSNQSNGIIVVYEITWVKVANTTRS 266 Query: 466 VNVLATPSSSRITIGGLALMHQATLPCDLGYINP---IIKSPIPYTNHPRLN 612 L SS+ + L LPC + I+ I P P+T LN Sbjct: 267 RRALDAASSANTSSTSYRLTD--LLPCSVYNISVRGYTIAGPGPFTRPLSLN 316 >SB_48885| Best HMM Match : DUF741 (HMM E-Value=0.88) Length = 841 Score = 28.7 bits (61), Expect = 6.8 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +1 Query: 460 EGVNVLATPSSSRITIGGLALMHQATLPCDLGYINPIIKSPIPYTNHPRLNIH 618 E V + +PS+S +TI G +L + P G +P + S P N P IH Sbjct: 560 EVVTTIGSPSTSGVTITGTSLRGDSQAPAVSGSQSPPLTSSTPPMN-PSNPIH 611 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.8 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +2 Query: 536 PSPAISATSTRSSNPRFHTPTTPDLTS 616 P+PA + T T+ + P HTPTTP T+ Sbjct: 94 PTPATTPTPTKPT-PTAHTPTTPTPTA 119 >SB_27194| Best HMM Match : C2 (HMM E-Value=1e-22) Length = 139 Score = 28.3 bits (60), Expect = 9.0 Identities = 18/55 (32%), Positives = 28/55 (50%) Frame = +2 Query: 566 RSSNPRFHTPTTPDLTSISINPLDAVLKRSSRRGFKASGCHQRLHQRISPPSFTG 730 ++ NP+F T DL + S+ LD + + ASGCH+R+ Q + S G Sbjct: 62 KTVNPKFAQTFTFDLAADSV--LDMMTMTFTVMVQDASGCHERIGQVVLSASSDG 114 >SB_20390| Best HMM Match : LRR_1 (HMM E-Value=0.34) Length = 108 Score = 28.3 bits (60), Expect = 9.0 Identities = 20/72 (27%), Positives = 38/72 (52%) Frame = +1 Query: 412 IPVTVDLCWTTADVTVEGVNVLATPSSSRITIGGLALMHQATLPCDLGYINPIIKSPIPY 591 +P + LC + +++E + A PS +I GG +L+ Q G++ + S +PY Sbjct: 18 LPYELVLCGSLQIMSIENCPLSALPS--QIVAGGPSLVIQ-------GFVFHVSCSWLPY 68 Query: 592 TNHPRLNIHFHQ 627 ++ PR I+F + Sbjct: 69 SSEPRHAINFRE 80 >SB_15184| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 208 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 524 CIKPPSPAISATSTRSSNPRFHTPTTPDLTSIS-INPLD 637 CIKP S IS + T N PD+ IS I P+D Sbjct: 57 CIKPASSHISDSLTTILNQSLQQGVVPDILKISKITPVD 95 >SB_31263| Best HMM Match : TP2 (HMM E-Value=5.5) Length = 177 Score = 28.3 bits (60), Expect = 9.0 Identities = 12/26 (46%), Positives = 15/26 (57%) Frame = +3 Query: 567 DHQIPDSIHQPPQT*HPFPSIPWTPY 644 D +PD I PPQ HP + PW P+ Sbjct: 153 DPFLPD-IKSPPQDQHPGETTPWEPF 177 >SB_17488| Best HMM Match : Phi-29_GP3 (HMM E-Value=0.69) Length = 250 Score = 28.3 bits (60), Expect = 9.0 Identities = 16/39 (41%), Positives = 19/39 (48%), Gaps = 1/39 (2%) Frame = +2 Query: 524 CIKPPSPAISATSTRSSNPRFHTPTTPDLTSIS-INPLD 637 CIKP S IS + T N PD+ IS I P+D Sbjct: 99 CIKPASSHISDSLTTILNQSLQQGVVPDILKISKITPVD 137 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,420,283 Number of Sequences: 59808 Number of extensions: 549853 Number of successful extensions: 1702 Number of sequences better than 10.0: 20 Number of HSP's better than 10.0 without gapping: 1457 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1695 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2609867019 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -