BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H15 (854 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor p... 30 0.024 AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic ac... 29 0.072 DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor p... 28 0.095 AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. 26 0.38 AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamat... 24 1.6 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 24 2.1 AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc fi... 23 4.7 DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channe... 22 6.3 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 6.3 AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic ac... 22 8.3 >DQ091184-1|AAZ42364.1| 157|Apis mellifera lipophorin receptor protein. Length = 157 Score = 30.3 bits (65), Expect = 0.024 Identities = 16/53 (30%), Positives = 22/53 (41%), Gaps = 6/53 (11%) Frame = +3 Query: 450 VDECATNNGGCEQRCVNDPGS------FHCECSPPLSLASDGKKCVPRIPLAI 590 +++C NG C C+ P C C L L SDG CV ++ I Sbjct: 33 MNQCQAVNGHCSHLCLPAPRINSKSPLLSCACPDGLKLLSDGLMCVEKVSTTI 85 >AY500239-1|AAR92109.1| 555|Apis mellifera neuronal nicotinic acetylcholine receptoralpha7-1 protein. Length = 555 Score = 28.7 bits (61), Expect = 0.072 Identities = 14/36 (38%), Positives = 19/36 (52%) Frame = -3 Query: 516 GSFQDH*RSVAHTHHCSSHTRLHQHNTAALAWNSFP 409 G H + H HH + T HQH+T LA +S+P Sbjct: 420 GHGHSHIHATPHHHHSHAATPHHQHST-PLAHSSYP 454 >DQ091183-1|AAZ42363.1| 128|Apis mellifera lipophorin receptor protein. Length = 128 Score = 28.3 bits (60), Expect = 0.095 Identities = 15/48 (31%), Positives = 20/48 (41%), Gaps = 6/48 (12%) Frame = +3 Query: 450 VDECATNNGGCEQRCVNDPGS------FHCECSPPLSLASDGKKCVPR 575 +++C NG C C+ P C C L L SDG CV + Sbjct: 33 MNQCQAVNGHCSHLCLPAPRINSKSPLLSCACPDGLKLLSDGLMCVEK 80 >AY921579-1|AAX14899.1| 996|Apis mellifera ephrin receptor protein. Length = 996 Score = 26.2 bits (55), Expect = 0.38 Identities = 18/67 (26%), Positives = 25/67 (37%), Gaps = 2/67 (2%) Frame = +3 Query: 378 CSCYPGFQFNAESYSKQEQPYCVDVDECATNN-GGCEQRC-VNDPGSFHCECSPPLSLAS 551 C C PG+Q + E E P E +++ C +D G C C P A Sbjct: 247 CHCKPGYQADVEKQECTECPIGKFKHEAGSHSCEACPAHSKSSDYGFTECRCDPGYFRAE 306 Query: 552 DGKKCVP 572 K +P Sbjct: 307 KDPKKMP 313 >AB161182-1|BAD08344.1| 1040|Apis mellifera metabotropic glutamate receptor protein. Length = 1040 Score = 24.2 bits (50), Expect = 1.6 Identities = 11/34 (32%), Positives = 15/34 (44%) Frame = -2 Query: 367 SPCTSHACSHRFRLHGSIDFGIHRPATCWCVSQQ 266 +P T H H R S+D HR W V ++ Sbjct: 77 NPETHHPIRHGRRQSRSMDLNAHREQMSWPVKKE 110 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 23.8 bits (49), Expect = 2.1 Identities = 15/51 (29%), Positives = 24/51 (47%) Frame = +3 Query: 480 CEQRCVNDPGSFHCECSPPLSLASDGKKCVPRIPLAIAEPLPLVRASSRCY 632 CE C++D + LSL S+ + AEP P+ +A S+C+ Sbjct: 666 CETFCLDDDDTL---LEVALSLGSEALSAAT-VRFIEAEPQPIGKALSKCH 712 >AB208107-1|BAE72139.1| 71|Apis mellifera Broad complex zinc finger domain-Z2 isoform protein. Length = 71 Score = 22.6 bits (46), Expect = 4.7 Identities = 11/32 (34%), Positives = 14/32 (43%) Frame = -2 Query: 271 QQCSLTHCTSASPTRHVCRDRNTRSVGHRAVL 176 Q C C+ AS RHV R +R V+ Sbjct: 9 QLCGKVLCSKASLKRHVADKHAERQEEYRCVI 40 >DQ667183-1|ABG75735.1| 463|Apis mellifera GABA-gated ion channel protein. Length = 463 Score = 22.2 bits (45), Expect = 6.3 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 618 SSRCYAPCDTVXVVDQESETAERSTARDTRRLKK 719 S CY D ESET+ DTR LKK Sbjct: 305 SGECYFSSDL-----SESETSSDEEEADTRPLKK 333 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 22.2 bits (45), Expect = 6.3 Identities = 9/12 (75%), Positives = 9/12 (75%) Frame = -3 Query: 396 TQGSRNTTYSLP 361 TQ SRN TYS P Sbjct: 1297 TQPSRNNTYSTP 1308 >AY569781-1|AAS75781.1| 461|Apis mellifera neuronal nicotinic acetylcholine Apisa7-2 subunit protein. Length = 461 Score = 21.8 bits (44), Expect = 8.3 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +2 Query: 5 GYPAGARPAVEMRPPL 52 GY AG RPA PL Sbjct: 16 GYDAGVRPAENSSQPL 31 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 229,627 Number of Sequences: 438 Number of extensions: 4726 Number of successful extensions: 16 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27552579 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -