BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H13 (843 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z81042-7|CAE46660.1| 371|Caenorhabditis elegans Hypothetical pr... 29 5.5 Z73976-9|CAA98280.2| 371|Caenorhabditis elegans Hypothetical pr... 29 5.5 AF078788-1|AAC26965.2| 629|Caenorhabditis elegans Hypothetical ... 28 7.2 >Z81042-7|CAE46660.1| 371|Caenorhabditis elegans Hypothetical protein T07C12.11 protein. Length = 371 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 57 PRHLISDAHEWINEILTVPIYYLAKPQPRERAWENQRGK 173 P H ++D I +++++ I Y +P ER W++ R K Sbjct: 38 PLHKVTDYKHEIWKLISIEIGYDGQPVELERKWKHMRDK 76 >Z73976-9|CAA98280.2| 371|Caenorhabditis elegans Hypothetical protein T07C12.11 protein. Length = 371 Score = 28.7 bits (61), Expect = 5.5 Identities = 12/39 (30%), Positives = 22/39 (56%) Frame = +3 Query: 57 PRHLISDAHEWINEILTVPIYYLAKPQPRERAWENQRGK 173 P H ++D I +++++ I Y +P ER W++ R K Sbjct: 38 PLHKVTDYKHEIWKLISIEIGYDGQPVELERKWKHMRDK 76 >AF078788-1|AAC26965.2| 629|Caenorhabditis elegans Hypothetical protein ZC190.4 protein. Length = 629 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/45 (28%), Positives = 28/45 (62%) Frame = -2 Query: 362 LGTKHRAPADIIDRAPLPPNRVSNETMKVVVFQRRSRETISHLCY 228 +GT+ + DIID +P N +S++ + +++ R ET++H+ + Sbjct: 287 VGTR-KTSTDIIDGFNVPSNMISDDNLPALIY--RVIETLNHMIF 328 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,145,954 Number of Sequences: 27780 Number of extensions: 407191 Number of successful extensions: 1029 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 972 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1029 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2087513582 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -