BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H10 (872 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 08_02_0875 + 22103903-22106293 31 0.91 07_01_0373 + 2783596-2784933 31 0.91 01_01_0448 - 3332238-3332330,3332414-3332481,3332570-3332618,333... 31 0.91 12_02_1174 - 26696869-26698191 31 1.2 06_03_1310 + 29238644-29240260 31 1.6 06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926,999... 31 1.6 01_06_1224 - 35508842-35510404 30 2.1 02_03_0132 - 15584673-15584789,15584957-15585054,15585151-15585550 30 2.8 02_04_0452 + 23044190-23045227 29 3.7 02_01_0219 - 1437685-1437723,1437932-1438091,1438385-1438514,143... 29 3.7 04_01_0041 - 464695-464850,467485-469029 29 6.4 01_05_0227 - 19512866-19514983 29 6.4 01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 29 6.4 02_05_0788 + 31758119-31758384,31758482-31758634,31759385-317595... 28 8.5 >08_02_0875 + 22103903-22106293 Length = 796 Score = 31.5 bits (68), Expect = 0.91 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +2 Query: 536 PSPAISATSTRSSNPRFHTPTTPDLTSISINPLNAVLKGV-RAGVKASG 679 P+P ++A S R NP+ PDL + +N L A GV AG+ + G Sbjct: 506 PAPVVAAFSARGPNPQSPEILKPDLIAPGLNILAAWPSGVGPAGIPSDG 554 >07_01_0373 + 2783596-2784933 Length = 445 Score = 31.5 bits (68), Expect = 0.91 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -1 Query: 92 EEEKALTKEGMAEAAETXKGTISSMNRS 9 E+++ LTK G + +ET KG++ S++RS Sbjct: 151 EQQQQLTKSGCSSTSETSKGSVLSLSRS 178 >01_01_0448 - 3332238-3332330,3332414-3332481,3332570-3332618, 3332716-3332798,3332900-3333023,3333389-3333486, 3333555-3333634,3333712-3333782,3333872-3333953, 3334158-3334237,3334365-3334416,3334843-3334958 Length = 331 Score = 31.5 bits (68), Expect = 0.91 Identities = 13/20 (65%), Positives = 15/20 (75%) Frame = +2 Query: 545 AISATSTRSSNPRFHTPTTP 604 A S+T+TR S PR H PTTP Sbjct: 2 AASSTATRLSPPRLHAPTTP 21 >12_02_1174 - 26696869-26698191 Length = 440 Score = 31.1 bits (67), Expect = 1.2 Identities = 21/56 (37%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +3 Query: 519 PYASSHPPLRSRLH-QPDHQIPDSIHQPPQT*HPFPSIP*TPY*KEFAPGLKPPVV 683 P PP R+R +P H+ P QPP + P P P P P +KPPVV Sbjct: 121 PVPPPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPPPPPPPPPPR-PPSVKPPVV 175 >06_03_1310 + 29238644-29240260 Length = 538 Score = 30.7 bits (66), Expect = 1.6 Identities = 35/133 (26%), Positives = 44/133 (33%) Frame = +3 Query: 474 AGHPFILSHYYWRSRPYASSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFPSIP*TPY*KE 653 A HPF S ++ P + P R+ L H+ P H PP+ P P P +P Sbjct: 351 AAHPFDCSKAQCQATPPTTRRPGGRTPL--APHRSPLPHHMPPRRTPPTPPPPSSPTPSH 408 Query: 654 FAPGLKPPVVIRXSISVSHPLVTGHG*RGFAPLFSSE**IXSFAPYXSSFXHXPXPPXIT 833 P PP S P + G +P SS Y P PP T Sbjct: 409 LPP--PPPTYSESPKSSMPPSTSPPSSHGASPPSSSSSPPTEHPGYVLP-PLTPPPPTTT 465 Query: 834 PXXKSVXAXTXPS 872 P PS Sbjct: 466 PPGHHAPVPGTPS 478 >06_01_1169 + 9996068-9996265,9996356-9998589,9998675-9998926, 9999007-9999117,9999207-9999288,9999563-9999754 Length = 1022 Score = 30.7 bits (66), Expect = 1.6 Identities = 22/51 (43%), Positives = 25/51 (49%), Gaps = 1/51 (1%) Frame = +3 Query: 531 SHPPLRSRLHQPDHQIPDSIHQPP-QT*HPFPSIP*TPY*KEFAPGLKPPV 680 S PPLRS QP P QPP T P + P +P K+ AP PPV Sbjct: 584 SPPPLRSPPRQPTPP-PSPSQQPPLPTPQPVQASPTSPT-KQHAPPAPPPV 632 >01_06_1224 - 35508842-35510404 Length = 520 Score = 30.3 bits (65), Expect = 2.1 Identities = 22/59 (37%), Positives = 26/59 (44%), Gaps = 6/59 (10%) Frame = +3 Query: 519 PYASSH----PPLRS--RLHQPDHQIPDSIHQPPQT*HPFPSIP*TPY*KEFAPGLKPP 677 PY+ SH PPL+ L+ PD H PP P P + P EF GL PP Sbjct: 25 PYSPSHADLSPPLQEVYSLYNPDDPPASETHLPPYAPPPAPVVSELPDDLEF--GLHPP 81 >02_03_0132 - 15584673-15584789,15584957-15585054,15585151-15585550 Length = 204 Score = 29.9 bits (64), Expect = 2.8 Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 3/38 (7%) Frame = +2 Query: 527 IKPPSPAISATSTR-SSNPR--FHTPTTPDLTSISINP 631 I PPSPA + S+R S +PR F TP T T+ S +P Sbjct: 25 ITPPSPASTPRSSRPSESPRSGFSTPATAPRTAASPSP 62 >02_04_0452 + 23044190-23045227 Length = 345 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/41 (34%), Positives = 18/41 (43%) Frame = +3 Query: 480 HPFILSHYYWRSRPYASSHPPLRSRLHQPDHQIPDSIHQPP 602 H +L H+ +A SH SR H P + P S PP Sbjct: 166 HGCLLLHHAGHGHGHAHSHSHSHSRAHNPSTRPPTSAPPPP 206 >02_01_0219 - 1437685-1437723,1437932-1438091,1438385-1438514, 1438627-1438696,1439264-1439407,1439771-1439837, 1439970-1440019,1440386-1440559,1440881-1440934, 1441008-1441112 Length = 330 Score = 29.5 bits (63), Expect = 3.7 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 2/85 (2%) Frame = +1 Query: 283 TETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSL--KIPVTVDLCWTTADVT 456 TE +N V V L SS GY D + ++ V + K+ V +D TAD++ Sbjct: 167 TEAGANRVLVCDLH--SSQAMGYFDIPVDHVYGQVMNLIGDVRGKVAVMMDDMIDTADIS 224 Query: 457 VEGVNVLATPSSSRITIGGLALMHQ 531 + +N+L P G L+HQ Sbjct: 225 LPNINILMKPIKLGTIAKGAELLHQ 249 >04_01_0041 - 464695-464850,467485-469029 Length = 566 Score = 28.7 bits (61), Expect = 6.4 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +1 Query: 244 IIPFQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPS-APSLKIPV 420 +I R + D++ T +SN + V +LP VSS + Y D ++ + P P ++ V Sbjct: 40 LISVFRPFTDVSLTLCRSNYIGVTNLPIVSSECEAYYDDFVSGADFTARPQVVPPWRLAV 99 Query: 421 TVD 429 +D Sbjct: 100 PLD 102 >01_05_0227 - 19512866-19514983 Length = 705 Score = 28.7 bits (61), Expect = 6.4 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -1 Query: 461 STVTSAVVQQRSTVTGILRLGAEGKTTASRL 369 S +T + +QQ + ++ LG GKTT ++L Sbjct: 18 SKLTESSIQQNIKIVSVIGLGGSGKTTLAKL 48 >01_01_0487 - 3591171-3592313,3593522-3593800,3594688-3595008 Length = 580 Score = 28.7 bits (61), Expect = 6.4 Identities = 18/52 (34%), Positives = 23/52 (44%) Frame = +3 Query: 519 PYASSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFPSIP*TPY*KEFAPGLKP 674 P S PP + H P Q+P PP P PS+P P +AP +P Sbjct: 284 PTLQSQPPSQYPGHLPHSQVPPV---PPSA--PVPSVPALPRDPYYAPPAQP 330 >02_05_0788 + 31758119-31758384,31758482-31758634,31759385-31759509, 31759650-31759678,31760943-31761008,31761059-31761125, 31761226-31761370,31761404-31761451,31762014-31762182, 31762645-31762779,31762858-31763064,31763608-31763735, 31763815-31763866,31764046-31764060,31764502-31764609 Length = 570 Score = 28.3 bits (60), Expect = 8.5 Identities = 21/86 (24%), Positives = 36/86 (41%) Frame = +1 Query: 235 QRLIIPFQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKI 414 Q I + ++ L N TV + N + GY+ +N+ + PSLK Sbjct: 198 QVFCIVLEMFFYQLLQLLKVPNEKTVNVIENAIQTLPGYQPPKHINIGEYISSHVPSLK- 256 Query: 415 PVTVDLCWTTADVTVEGVNVLATPSS 492 D C T ++ +EG++ L S+ Sbjct: 257 ----DFCEPTVEM-LEGMSALKALST 277 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.317 0.132 0.396 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,320,399 Number of Sequences: 37544 Number of extensions: 472325 Number of successful extensions: 1418 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1333 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1417 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2456227356 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -