BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H09 (851 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z47072-2|CAA87369.3| 1317|Caenorhabditis elegans Hypothetical pr... 28 9.7 >Z47072-2|CAA87369.3| 1317|Caenorhabditis elegans Hypothetical protein F26C11.3 protein. Length = 1317 Score = 27.9 bits (59), Expect = 9.7 Identities = 25/96 (26%), Positives = 39/96 (40%), Gaps = 11/96 (11%) Frame = +1 Query: 328 TSTYSQTLNG*ELRLTRTNGVS-FQACRVVTWRKRSSPFKTPA*SGSRTLPGGEFDWGGT 504 T+ Q + TRT S Q C+ + + + F P +RTLP GE + Sbjct: 1039 TTVLMQLIYNPSTNKTRTETTSDAQGCKATSTTQTPTTFNWPTGGTTRTLPSGEIILSES 1098 Query: 505 SVKE*RRC----------PKASSARTETSRGAKGQK 582 + + C P ++ RTET+ A+G K Sbjct: 1099 LIAY-KNCTTVLMQLIYNPSKNTTRTETTSDAEGCK 1133 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,679,120 Number of Sequences: 27780 Number of extensions: 440082 Number of successful extensions: 982 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 945 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 982 length of database: 12,740,198 effective HSP length: 81 effective length of database: 10,490,018 effective search space used: 2118983636 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -