Bombyx BLAST Result against bee

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP01_FL5_H09
         (851 letters)

Database: bee 
           438 sequences; 146,343 total letters

Searching......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.        24   2.0  
D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.    22   8.2  
AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase pro...    22   8.2  

>AY703685-1|AAU12681.1|  200|Apis mellifera abdominal-A protein.
          Length = 200

 Score = 23.8 bits (49), Expect = 2.0
 Identities = 11/44 (25%), Positives = 20/44 (45%)
 Frame = -1

Query: 578 CPFAPREVSVLAELALGHLRYSLTDVPPQSNSPPGSVLEPDHAG 447
           C  +P   S+ + L+   +  +  +   Q NSP  +   P H+G
Sbjct: 30  CTTSPATASLESSLSAAAVAAAAVNYAQQHNSPSPTGSSPQHSG 73


>D79208-1|BAA11466.1|  567|Apis mellifera alpha-glucosidase protein.
          Length = 567

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -2

Query: 202 LSPLYPVPTID 170
           LSP+YP P +D
Sbjct: 71  LSPIYPSPMVD 81


>AB253417-1|BAE86928.1|  567|Apis mellifera alpha-glucosidase
           protein.
          Length = 567

 Score = 21.8 bits (44), Expect = 8.2
 Identities = 7/11 (63%), Positives = 9/11 (81%)
 Frame = -2

Query: 202 LSPLYPVPTID 170
           LSP+YP P +D
Sbjct: 71  LSPIYPSPMVD 81


  Database: bee
    Posted date:  Oct 23, 2007  1:17 PM
  Number of letters in database: 146,343
  Number of sequences in database:  438
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 240,371
Number of Sequences: 438
Number of extensions: 5595
Number of successful extensions: 11
Number of sequences better than 10.0: 3
Number of HSP's better than 10.0 without gapping: 11
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 11
length of database: 146,343
effective HSP length: 57
effective length of database: 121,377
effective search space used: 27431202
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)