BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H07 (819 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4... 31 0.26 SPAC56E4.02c |alg13||N-acetylglucosaminyldiphosphodolichol N-ace... 27 3.2 SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||M... 27 4.2 SPCC1020.10 |oca2||serine/threonine protein kinase Oca2 |Schizos... 27 4.2 >SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4|Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 30.7 bits (66), Expect = 0.26 Identities = 14/35 (40%), Positives = 22/35 (62%), Gaps = 1/35 (2%) Frame = +2 Query: 242 VRVHRADTGRSSNELDRQTTELERRGMGL-QHLAG 343 +R H+ GR+ ELDR+ T+L++R L Q + G Sbjct: 18 LRAHQRSLGRAERELDRERTKLDQRERALIQEIKG 52 >SPAC56E4.02c |alg13||N-acetylglucosaminyldiphosphodolichol N-acetylglucosaminyltransferase Alg13 |Schizosaccharomyces pombe|chr 1|||Manual Length = 162 Score = 27.1 bits (57), Expect = 3.2 Identities = 11/33 (33%), Positives = 18/33 (54%) Frame = -3 Query: 166 YVARSESIMRDSDVAFSHSAALAIAQVRRNGNK 68 Y ES + D+ + SH+ A +I Q R+G + Sbjct: 63 YAPEIESYIHDASIVISHAGAGSILQTLRSGKR 95 >SPAC1F7.09c |||allantoicase |Schizosaccharomyces pombe|chr 1|||Manual Length = 342 Score = 26.6 bits (56), Expect = 4.2 Identities = 10/25 (40%), Positives = 16/25 (64%) Frame = -2 Query: 320 FPCVPTQSFVDPIHLKICQYPHGGL 246 F +P Q+F H+++C YP GG+ Sbjct: 150 FKEIPQQNFT---HVRLCMYPDGGI 171 >SPCC1020.10 |oca2||serine/threonine protein kinase Oca2 |Schizosaccharomyces pombe|chr 3|||Manual Length = 650 Score = 26.6 bits (56), Expect = 4.2 Identities = 14/46 (30%), Positives = 24/46 (52%) Frame = +3 Query: 420 RARVSNNGSVSWIKRLDISTPISMQLDNWPNDMQTCTFKFGSRMHN 557 RA +++ + +KR DI + DNW ND+ C + G +H+ Sbjct: 588 RAVIAHMLELDPVKRYDIHRVFA---DNWINDISMCHMENGKVIHS 630 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,896,785 Number of Sequences: 5004 Number of extensions: 57975 Number of successful extensions: 160 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 158 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 160 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 400438000 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -