BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H06 (885 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 28 2.0 SPAC1F3.07c |rsc58||RSC complex subunit Rsc58|Schizosaccharomyce... 27 4.7 SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces ... 26 6.2 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.9 bits (59), Expect = 2.0 Identities = 16/47 (34%), Positives = 24/47 (51%), Gaps = 2/47 (4%) Frame = +2 Query: 467 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIQMFSTHRDCESTAY 601 Y+C + +S G L SED ++ W K GLI+ F + E+ Y Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173 >SPAC1F3.07c |rsc58||RSC complex subunit Rsc58|Schizosaccharomyces pombe|chr 1|||Manual Length = 403 Score = 26.6 bits (56), Expect = 4.7 Identities = 20/67 (29%), Positives = 34/67 (50%), Gaps = 3/67 (4%) Frame = -3 Query: 619 LYTKGSIGRAFAVPMRTEHLD-QASFCPFAPREVSVLAELALGHLR-YSLTDV-PPQSNS 449 L+ GS G F+ RT LD + + V++L ++ + + Y+L + PP + Sbjct: 125 LFMVGSAGPLFSSTARTSRLDSRLPDGGIIAKPVALLPTPSVANSQEYTLDKLSPPSTAK 184 Query: 448 PPGSVLE 428 PP SV+E Sbjct: 185 PPASVIE 191 >SPAC1F5.11c |||phosphatidylinositol kinase |Schizosaccharomyces pombe|chr 1|||Manual Length = 3655 Score = 26.2 bits (55), Expect = 6.2 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = -1 Query: 654 LWNXSGTSX*KLFILKDR*AVLSQSL 577 ++N G S KLFI+KD V+SQ L Sbjct: 3489 VFNIGGRSPQKLFIVKDSGQVMSQDL 3514 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,158,768 Number of Sequences: 5004 Number of extensions: 61503 Number of successful extensions: 129 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 126 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 129 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 444486180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -