BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H04 (874 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) 32 0.70 SB_25387| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.6 SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) 29 3.8 SB_27881| Best HMM Match : Keratin_B2 (HMM E-Value=0.5) 29 3.8 SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) 29 3.8 SB_59599| Best HMM Match : rve (HMM E-Value=1.69557e-43) 29 5.0 SB_30122| Best HMM Match : YadA (HMM E-Value=2) 29 5.0 SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) 29 5.0 SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) 29 5.0 SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) 29 5.0 SB_48885| Best HMM Match : DUF741 (HMM E-Value=0.88) 29 6.6 SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.6 SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0) 28 8.7 SB_20390| Best HMM Match : LRR_1 (HMM E-Value=0.34) 28 8.7 SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 8.7 >SB_6924| Best HMM Match : TTL (HMM E-Value=4.4e-09) Length = 458 Score = 31.9 bits (69), Expect = 0.70 Identities = 19/47 (40%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +1 Query: 415 TSHS*PLLDYC*RHS*RSQCAGHPFILSHYYWRSRPY--ASSHPPLR 549 T + LL YC R AGHPF+L Y + R Y +S PLR Sbjct: 91 TKYDIDLLGYCTEQEIRRVVAGHPFLLDGYKFDLRVYVLVTSCDPLR 137 >SB_25387| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 533 Score = 31.1 bits (67), Expect = 1.2 Identities = 30/105 (28%), Positives = 44/105 (41%), Gaps = 10/105 (9%) Frame = +1 Query: 475 AGHPFILSHYYWRSRPYASSH------PPLRSRLHQPDHQIPDSIHQPPQT*H-PFPSIP 633 + HP + H+ +S P+ SSH PP + LH+PD+ + HQ T P + Sbjct: 289 SAHPSQVPHH--KSEPHTSSHKPQLWVPPTQQSLHKPDNPHKNPYHQSSITQQAPKAAEL 346 Query: 634 *TPYXKEFAPGLKPPLSSEAPSAYLTPSSLGM---AKGVSPPYFQ 759 + +P +PP PSA L G A+G P Q Sbjct: 347 KAAHPPSHSPQTQPP--DRQPSASLPAQYQGQQPYAQGPQPQQSQ 389 >SB_33678| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1308 Score = 30.7 bits (66), Expect = 1.6 Identities = 24/82 (29%), Positives = 37/82 (45%), Gaps = 1/82 (1%) Frame = +1 Query: 517 RPYASSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPGLKPPLSSEAP 696 +PY + PP+ S +Q +P + P P P +P + Y + PG+ P +S P Sbjct: 905 QPYNTPMPPISSTPYQAPPTLPPTTLTTPSWSQPVP-VP-SMYQPQ-PPGIMQPPTSIPP 961 Query: 697 SAYLTPSSL-GMAKGVSPPYFQ 759 S + P S + G PP Q Sbjct: 962 SQPMAPPSFPPSSMGGFPPSSQ 983 >SB_33380| Best HMM Match : Herpes_capsid (HMM E-Value=3) Length = 474 Score = 29.5 bits (63), Expect = 3.8 Identities = 18/63 (28%), Positives = 28/63 (44%) Frame = -1 Query: 457 CDVSSSPTKVNCDWYFEARGGRKNDSLKIDKIRVAVAFYDGGDVR**LHSDTVRFGFGAS 278 C + P + W+F + G K DS + + + G V +HS VR G GA+ Sbjct: 275 CVRAHLPNAADQPWFFLSNTGAKIDSNNVQSLLRSFQRSTGVQVSKPIHSTAVRCGSGAT 334 Query: 277 KIE 269 + E Sbjct: 335 EEE 337 >SB_27881| Best HMM Match : Keratin_B2 (HMM E-Value=0.5) Length = 168 Score = 29.5 bits (63), Expect = 3.8 Identities = 21/63 (33%), Positives = 28/63 (44%), Gaps = 3/63 (4%) Frame = +1 Query: 463 RSQCAGHPFILSHYYWRSRPYASSHPPLRSRLHQP---DHQIPDSIHQPPQT*HPFPSIP 633 +S C HP Y +P SHP R +QP +H I ++QP HP +IP Sbjct: 31 QSSCINHPVSTILY----QPSCISHPVSTIR-YQPSRINHPISTILYQPSHINHPVSTIP 85 Query: 634 *TP 642 P Sbjct: 86 YQP 88 >SB_45519| Best HMM Match : RNB (HMM E-Value=1.6e-35) Length = 2748 Score = 29.5 bits (63), Expect = 3.8 Identities = 15/46 (32%), Positives = 26/46 (56%), Gaps = 2/46 (4%) Frame = +3 Query: 594 PTTPDLTSISINPLNAVLXGVRAGVKASVVIRGSI--SVSHPLVTG 725 PT+P++TS S P ++AG + VV+ ++ SV P++ G Sbjct: 1911 PTSPEMTSRSGQPFKRFTKHIKAGDRLRVVMGSTVLKSVLQPVIQG 1956 >SB_59599| Best HMM Match : rve (HMM E-Value=1.69557e-43) Length = 1803 Score = 29.1 bits (62), Expect = 5.0 Identities = 22/66 (33%), Positives = 31/66 (46%), Gaps = 8/66 (12%) Frame = -1 Query: 592 VWNRGFDDRVDVAEIAGEG----GLMHKGE-TANSNARG*RGGQHIDSFNCD---VSSSP 437 +W++ +DVAE+AG G GL + TA S G HID F C +S P Sbjct: 1545 LWHKDTAGHIDVAEVAGGGATNEGLKKRAAYTAQSVEVGLIVNLHIDIFKCGRYLLSGVP 1604 Query: 436 TKVNCD 419 K+ + Sbjct: 1605 MKIRLE 1610 >SB_30122| Best HMM Match : YadA (HMM E-Value=2) Length = 408 Score = 29.1 bits (62), Expect = 5.0 Identities = 12/37 (32%), Positives = 22/37 (59%) Frame = +2 Query: 395 SAPSLKIPVTVDLCWTTADVTVEGVNVLATPSSSRIT 505 S P K+P+T T+A+VT +++ +PS + +T Sbjct: 239 SRPETKVPITTIGASTSAEVTTSQRDLMPSPSQAHVT 275 >SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 1433 Score = 29.1 bits (62), Expect = 5.0 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = +2 Query: 269 FDLTGTETKSNSVTVQS---LPNVSSIIKGYRDAYLVNL 376 F +TG E KS+S+T++ +P V ++ +G D +LV+L Sbjct: 485 FTITGQEGKSDSITIRHADVIPRV-ALARGNEDVFLVHL 522 >SB_13377| Best HMM Match : Extensin_2 (HMM E-Value=0.00046) Length = 797 Score = 29.1 bits (62), Expect = 5.0 Identities = 24/84 (28%), Positives = 32/84 (38%) Frame = +1 Query: 505 YWRSRPYASSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPGLKPPLS 684 Y+ R S PL LH P Q+P + P P +P + F P + P Sbjct: 191 YFTPRVIHSPRTPLPRVLHSPRTQLP-AYFIPRVLPSPLNQLPAYTTPRYFTPRVLPSPR 249 Query: 685 SEAPSAYLTPSSLGMAKGVSPPYF 756 ++ P AY T L P YF Sbjct: 250 NQLP-AYTTHRVLHSPHNPLPAYF 272 >SB_30304| Best HMM Match : fn3 (HMM E-Value=1.5e-32) Length = 808 Score = 29.1 bits (62), Expect = 5.0 Identities = 30/112 (26%), Positives = 43/112 (38%), Gaps = 5/112 (4%) Frame = +2 Query: 293 KSNSVTVQSLPNVS--SIIKGYRDAYLVNLEAVVFPSAPSLKIPVTVDLCWTTADVTVEG 466 +++ VT Q P+ S + GY D N+ PS S I V ++ W T Sbjct: 207 EAHIVTEQEAPSCSPEDLAVGYSDGKAHNITWSPIPSNQSNGIIVVYEITWVKVANTTRS 266 Query: 467 VNVLATPSSSRITIGGLALMHQATLPCDLGYINP---IIKSPIPYTNHPRLN 613 L SS+ + L LPC + I+ I P P+T LN Sbjct: 267 RRALDAASSANTSSTSYRLTD--LLPCSVYNISVRGYTIAGPGPFTRPLSLN 316 >SB_48885| Best HMM Match : DUF741 (HMM E-Value=0.88) Length = 841 Score = 28.7 bits (61), Expect = 6.6 Identities = 18/53 (33%), Positives = 26/53 (49%) Frame = +2 Query: 461 EGVNVLATPSSSRITIGGLALMHQATLPCDLGYINPIIKSPIPYTNHPRLNIH 619 E V + +PS+S +TI G +L + P G +P + S P N P IH Sbjct: 560 EVVTTIGSPSTSGVTITGTSLRGDSQAPAVSGSQSPPLTSSTPPMN-PSNPIH 611 >SB_39550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 6.6 Identities = 13/27 (48%), Positives = 18/27 (66%) Frame = +3 Query: 537 PSPAISATSTRSSNPRFHTPTTPDLTS 617 P+PA + T T+ + P HTPTTP T+ Sbjct: 94 PTPATTPTPTKPT-PTAHTPTTPTPTA 119 >SB_39072| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1011 Score = 28.7 bits (61), Expect = 6.6 Identities = 22/71 (30%), Positives = 26/71 (36%) Frame = +1 Query: 514 SRPYASSHPPLRSRLHQPDHQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPGLKPPLSSEA 693 S P S P S H P S P T PS+P TP P++ Sbjct: 662 STPSTPSTPSTPSLTHTPSTPSTPSTPSTPST----PSMPNTPSTPSTPSTPSTPITPGT 717 Query: 694 PSAYLTPSSLG 726 PS TPS+ G Sbjct: 718 PSTPSTPSAPG 728 >SB_22404| Best HMM Match : SNF2_N (HMM E-Value=0) Length = 1918 Score = 28.3 bits (60), Expect = 8.7 Identities = 23/93 (24%), Positives = 35/93 (37%), Gaps = 2/93 (2%) Frame = +1 Query: 484 PFILSHYYWRSRPYASSHP--PLRSRLHQPDHQIPDSIHQPPQT*HPFPSIP*TPYXKEF 657 P+ S + P + +P P R+ H S+ P + H PS + Sbjct: 49 PYKTSPFMPPQSPGSMQNPVSPHRTYQHNLPRGSQSSVPPSPHSYHSAPSPSRYAGPSAY 108 Query: 658 APGLKPPLSSEAPSAYLTPSSLGMAKGVSPPYF 756 PG P S + TPSS+ +SP +F Sbjct: 109 MPGAISPSSGICTPSCATPSSVMSPGPISPDFF 141 >SB_20390| Best HMM Match : LRR_1 (HMM E-Value=0.34) Length = 108 Score = 28.3 bits (60), Expect = 8.7 Identities = 20/72 (27%), Positives = 38/72 (52%) Frame = +2 Query: 413 IPVTVDLCWTTADVTVEGVNVLATPSSSRITIGGLALMHQATLPCDLGYINPIIKSPIPY 592 +P + LC + +++E + A PS +I GG +L+ Q G++ + S +PY Sbjct: 18 LPYELVLCGSLQIMSIENCPLSALPS--QIVAGGPSLVIQ-------GFVFHVSCSWLPY 68 Query: 593 TNHPRLNIHFHQ 628 ++ PR I+F + Sbjct: 69 SSEPRHAINFRE 80 >SB_21376| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 290 Score = 28.3 bits (60), Expect = 8.7 Identities = 18/66 (27%), Positives = 24/66 (36%), Gaps = 3/66 (4%) Frame = +1 Query: 565 PDHQIPDSIHQPPQT*HPFPSIP*TPYXKEF---APGLKPPLSSEAPSAYLTPSSLGMAK 735 P + P + PP P+P P PY P PP + P Y P + Sbjct: 130 PPYPPPPNAPYPPSPNAPYPPPPNPPYPPPLYPPPPNPPPPNAPYPPPPYPPPPNPPYPP 189 Query: 736 GVSPPY 753 +PPY Sbjct: 190 PPNPPY 195 >SB_15888| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2437 Score = 28.3 bits (60), Expect = 8.7 Identities = 15/48 (31%), Positives = 23/48 (47%) Frame = +1 Query: 655 FAPGLKPPLSSEAPSAYLTPSSLGMAKGVSPPYFQVNDESQASRLIXR 798 FA P SS++PSA +P+S SP F + E + +I + Sbjct: 1096 FATTTMSPTSSQSPSAVTSPTSPRSPSNPSPASFGFHSEDEPVTMISK 1143 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 24,813,811 Number of Sequences: 59808 Number of extensions: 519224 Number of successful extensions: 1786 Number of sequences better than 10.0: 18 Number of HSP's better than 10.0 without gapping: 1495 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1775 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2503194881 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -