BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H03 (844 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) 331 5e-91 SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) 36 0.041 SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.17 SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) 31 1.5 SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) 30 2.7 SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) 29 3.6 SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) 29 4.7 SB_54185| Best HMM Match : Gal_Lectin (HMM E-Value=2.3) 29 4.7 SB_43606| Best HMM Match : Y_phosphatase (HMM E-Value=3.9e-26) 29 4.7 SB_37694| Best HMM Match : PSI_PsaE (HMM E-Value=7.4) 29 6.2 SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 6.2 SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) 28 8.2 SB_11563| Best HMM Match : SNF7 (HMM E-Value=0.28) 28 8.2 >SB_11396| Best HMM Match : Ribosomal_S2 (HMM E-Value=0) Length = 328 Score = 331 bits (813), Expect = 5e-91 Identities = 154/217 (70%), Positives = 177/217 (81%) Frame = +3 Query: 69 MSGGLDVLALNEEDVTKMLAATTHLGAENVNFQMETYVYKRRADGTHVINLRRTWEKLVL 248 MSGGLD+L L EEDV K LAA HLGA N +FQME YVYKR++DG ++IN+++TWEKL+L Sbjct: 1 MSGGLDILQLKEEDVVKFLAAGVHLGANNCDFQMEDYVYKRKSDGVNIINVKKTWEKLLL 60 Query: 249 AARAVVAIENPADVFVISSRPFGQRAVLKFAAHTGATPIAGRFTPGAFTNQIQAAFREPR 428 AAR +V IENPADV VIS+RP+GQRA+LK+A+HTGATPIAGRFTPG FTNQIQAAFREPR Sbjct: 61 AARIIVTIENPADVCVISARPYGQRAILKYASHTGATPIAGRFTPGTFTNQIQAAFREPR 120 Query: 429 LLIVLDPAQDHQPITEASYVNIPVIALCNTDSPLRFVDIAIPCNTKSSHSIGLMWWLLAR 608 LLIV DP DHQP+TEASYVNIPVIA CNTDSPLR VD+AIPCN K HSIGLM+WLLAR Sbjct: 121 LLIVCDPRIDHQPVTEASYVNIPVIAFCNTDSPLRHVDVAIPCNNKGIHSIGLMFWLLAR 180 Query: 609 EVLRLRGVLPRDQRWXXXXXXXXXXXXEESEKDEQQA 719 EVLR+RG + R W EE+EK+EQ A Sbjct: 181 EVLRMRGSISRALPWEIMPDLYFYRDPEEAEKEEQAA 217 >SB_24578| Best HMM Match : rve (HMM E-Value=4.8e-35) Length = 1772 Score = 35.9 bits (79), Expect = 0.041 Identities = 24/67 (35%), Positives = 33/67 (49%), Gaps = 4/67 (5%) Frame = -1 Query: 670 KSTTTSQRWSRGSTPRSLNTSRANNHHIKPIEWEDLVLHGIAMST-NLSGE---SVLHKA 503 K+TT RWS+G TP ++ H I L+ HG ST NL+ E VL++ Sbjct: 1396 KTTTDKTRWSKGQTPNGKVAQKSKFQH--GIAGTQLIYHGTGPSTKNLTTEQAKQVLNEN 1453 Query: 502 ITGMLTY 482 G +TY Sbjct: 1454 ELGTMTY 1460 >SB_40833| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1300 Score = 33.9 bits (74), Expect = 0.17 Identities = 32/109 (29%), Positives = 43/109 (39%), Gaps = 5/109 (4%) Frame = +2 Query: 242 CSGCSCCRSHREPR*CVRHLITALRSACCTEVC--RAHRCYA---YCGTFHTRCFY*PDP 406 CS C R CV I L + C C + H A C H+ C Sbjct: 822 CSTCEGGNGLRNCSACVAPFI--LLDSYCVRECPQKGHFLNAKLRQCKKCHSSC-----S 874 Query: 407 SCIP*TSSLDCIGPCTRPSTHY*SFICQHSCDCFVQHRLPTKICGHCYP 553 SCI S+ DCI C+ PS F C+ +C T++C +C+P Sbjct: 875 SCIG-PSANDCI-TCSDPSNALIGFTCKANCTPGQFKNTATRVCENCHP 921 >SB_99| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 965 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/55 (34%), Positives = 27/55 (49%) Frame = -3 Query: 515 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNRRST 351 V SN +V + N + CR Q NQ T FT + ++ C+T RN RS+ Sbjct: 876 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMRSS 930 >SB_57493| Best HMM Match : Surf_Ag_VNR (HMM E-Value=0.00037) Length = 432 Score = 30.7 bits (66), Expect = 1.5 Identities = 15/32 (46%), Positives = 22/32 (68%) Frame = +3 Query: 441 LDPAQDHQPITEASYVNIPVIALCNTDSPLRF 536 LDP +HQPIT+ + I ++A TD+PL+F Sbjct: 119 LDPDVEHQPITDRAEACICLVA---TDAPLKF 147 >SB_49472| Best HMM Match : BDS_I_II (HMM E-Value=1.5) Length = 315 Score = 29.9 bits (64), Expect = 2.7 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 573 HSIGLMWWLLAREVLRLRGVLP 638 H G +WW+L E LR + VLP Sbjct: 46 HDDGSVWWVLTSESLRAKAVLP 67 >SB_50413| Best HMM Match : GRP (HMM E-Value=0.15) Length = 487 Score = 29.5 bits (63), Expect = 3.6 Identities = 17/48 (35%), Positives = 24/48 (50%), Gaps = 1/48 (2%) Frame = -3 Query: 674 NQINHNIPALVTGKHTTKPQHFTCQQPPHQTNRVGR-LGVAWDSNVHK 534 NQ+ + P +T HT+ T P HQ + +GR G DSNV + Sbjct: 244 NQMRGHEPRSITYNHTSITAPLTTGYPDHQGSYMGRYAGSVADSNVSR 291 >SB_58902| Best HMM Match : TNFR_c6 (HMM E-Value=0.032) Length = 397 Score = 29.1 bits (62), Expect = 4.7 Identities = 13/42 (30%), Positives = 22/42 (52%) Frame = +2 Query: 422 TSSLDCIGPCTRPSTHY*SFICQHSCDCFVQHRLPTKICGHC 547 TSSLD + PC+ S H+ + + C C+ +++ C C Sbjct: 331 TSSLDTLAPCSF-SCHFACDVNTNQCICYYGYQMSDNKCKAC 371 >SB_54185| Best HMM Match : Gal_Lectin (HMM E-Value=2.3) Length = 225 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -3 Query: 515 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNRR 357 V SN +V + N + CR Q NQ T FT + ++ C+T RN R Sbjct: 155 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMR 207 >SB_43606| Best HMM Match : Y_phosphatase (HMM E-Value=3.9e-26) Length = 280 Score = 29.1 bits (62), Expect = 4.7 Identities = 18/53 (33%), Positives = 25/53 (47%) Frame = -3 Query: 515 VAQSNHRNVDI*SFSNGLMVLCRVQYNQETRFTECSLDLVSKSTWCETSRNRR 357 V SN +V + N + CR Q NQ T FT + ++ C+T RN R Sbjct: 196 VYNSNKGSVRVHPSDNSGSLNCRKQTNQTTAFTWPGVVNLTWKRGCQTMRNMR 248 >SB_37694| Best HMM Match : PSI_PsaE (HMM E-Value=7.4) Length = 158 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/53 (32%), Positives = 30/53 (56%) Frame = +1 Query: 268 PSRTPLMCSSSHHGPSVSVLY*SLPRTPVLRLLRDVSHQVLLLTRSKLHSVNL 426 PSRTPL ++ +G +S+ Y VLR+ R H ++ ++R L ++N+ Sbjct: 49 PSRTPLSQHNNGYGLRISI-YAVRYTAMVLRINRFALHIIVTVSRITLSAINV 100 >SB_51220| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1601 Score = 28.7 bits (61), Expect = 6.2 Identities = 15/41 (36%), Positives = 23/41 (56%) Frame = -1 Query: 631 TPRSLNTSRANNHHIKPIEWEDLVLHGIAMSTNLSGESVLH 509 T +SLN S N + P EW + V+ G+ LSG ++L+ Sbjct: 864 TAQSLNVSVDNLKFLAPTEWRE-VIPGLKQEILLSGSNMLN 903 >SB_49599| Best HMM Match : DDE (HMM E-Value=3.7e-20) Length = 428 Score = 28.3 bits (60), Expect = 8.2 Identities = 19/52 (36%), Positives = 28/52 (53%), Gaps = 2/52 (3%) Frame = +3 Query: 417 REPR-LLIVLDPAQDHQPITEASYVNIPVIALC-NTDSPLRFVDIAIPCNTK 566 RE R +++ +D A H P + +Y NI +I L NT S + +D I N K Sbjct: 255 RENRNIMLFMDNAPCHTPSLKNTYCNIKIIFLSKNTTSKTQPLDSGIIANWK 306 >SB_11563| Best HMM Match : SNF7 (HMM E-Value=0.28) Length = 859 Score = 28.3 bits (60), Expect = 8.2 Identities = 14/28 (50%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -1 Query: 688 GH-GRRTKSTTTSQRWSRGSTPRSLNTS 608 GH GRR+ + + S WS STPR+ TS Sbjct: 435 GHYGRRSSAGSNSAPWSDASTPRNPATS 462 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 28,271,945 Number of Sequences: 59808 Number of extensions: 665186 Number of successful extensions: 1661 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1487 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1652 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2383424791 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -