BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H02 (855 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcript... 28 0.31 AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical prote... 25 2.2 >AB090819-2|BAC57914.1| 1022|Anopheles gambiae reverse transcriptase protein. Length = 1022 Score = 28.3 bits (60), Expect = 0.31 Identities = 8/25 (32%), Positives = 17/25 (68%) Frame = +2 Query: 326 GLRALLTVWAEHMSEDCRRRFYKNC 400 G+R ++WAE + +CR+++ + C Sbjct: 770 GIRYASSIWAESLKFECRKQWLRRC 794 >AJ438610-5|CAD27477.1| 135|Anopheles gambiae hypothetical protein protein. Length = 135 Score = 25.4 bits (53), Expect = 2.2 Identities = 16/61 (26%), Positives = 30/61 (49%), Gaps = 1/61 (1%) Frame = -3 Query: 217 VRFSNHVGHTGLITDKS-SQMNRFARVVFRERLDLTTMTTGPLFGIESHRPMXGVLKIFC 41 VR G +G ++ + + + F+ + +++ D+T TT F +R +L IFC Sbjct: 59 VRVRQLAGCSGYVSPRGGTNSDDFSPYIKQDKKDITFSTTQDNFPTPHNRITIVLLPIFC 118 Query: 40 A 38 A Sbjct: 119 A 119 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 873,561 Number of Sequences: 2352 Number of extensions: 17141 Number of successful extensions: 17 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90959220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -