BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H01 (919 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4... 29 0.92 SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosac... 26 8.6 >SPAC4F8.01 |did4|SPAC644.03c, vps2|vacuolar sorting protein Did4|Schizosaccharomyces pombe|chr 1|||Manual Length = 210 Score = 29.1 bits (62), Expect = 0.92 Identities = 11/25 (44%), Positives = 18/25 (72%) Frame = +2 Query: 227 VRVHRANTGRSSNELDRXTTELERR 301 +R H+ + GR+ ELDR T+L++R Sbjct: 18 LRAHQRSLGRAERELDRERTKLDQR 42 >SPAC23C4.02 |crn1||actin binding protein, coronin Crn1|Schizosaccharomyces pombe|chr 1|||Manual Length = 601 Score = 25.8 bits (54), Expect = 8.6 Identities = 16/44 (36%), Positives = 21/44 (47%) Frame = +3 Query: 258 LQMNWIDXRLSWNAGEWGCSTWLVSSERLWRPDVVLLNAGATTA 389 L +N ++WNAG G + +ER PD V L G T A Sbjct: 40 LSVNPFYLSVNWNAGAGGALAVIPLNERGKLPDQVNLFRGHTAA 83 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,156,977 Number of Sequences: 5004 Number of extensions: 37020 Number of successful extensions: 89 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 89 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 89 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 466510270 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -