BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_H01 (919 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0366 - 13102147-13102281,13102560-13102739,13102791-131029... 34 0.18 12_01_0524 - 4167867-4168445 29 3.9 >05_03_0366 - 13102147-13102281,13102560-13102739,13102791-13102992, 13104385-13104575 Length = 235 Score = 33.9 bits (74), Expect = 0.18 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -3 Query: 329 HQPSAAAPLPCVPTQSXVDPIHLKICXYSHGGLGLTNVSMSQM-QGQVDYDFGVGG 165 H P AAA P VP++ P L + S GG GL S S + G + D G+GG Sbjct: 7 HSPRAAAAAPSVPSR-LPRPFLLSLSSPSRGGSGLVAASASAVAAGGSEGDGGIGG 61 >12_01_0524 - 4167867-4168445 Length = 192 Score = 29.5 bits (63), Expect = 3.9 Identities = 22/72 (30%), Positives = 32/72 (44%) Frame = -3 Query: 326 QPSAAAPLPCVPTQSXVDPIHLKICXYSHGGLGLTNVSMSQMQGQVDYDFGVGGGVPIVR 147 QPS+AA P + + + + YSH G + S + G + G GGG P V Sbjct: 104 QPSSAAVAPLPSSTNLKSAVRSAMGSYSHSGTRRVHFGDSTVLG--EKAAGAGGGEPAV- 160 Query: 146 CEERVDHEGQ*C 111 EE + E + C Sbjct: 161 VEEVEEEEEKEC 172 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,046,442 Number of Sequences: 37544 Number of extensions: 337255 Number of successful extensions: 1016 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 992 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1016 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2612387020 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -