BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_G24 (919 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g07020.1 68415.m00803 protein kinase family protein contains ... 30 1.9 At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family prote... 29 5.7 At4g38560.1 68417.m05459 expressed protein 28 10.0 >At2g07020.1 68415.m00803 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 700 Score = 30.3 bits (65), Expect = 1.9 Identities = 13/32 (40%), Positives = 18/32 (56%) Frame = -3 Query: 299 DSSKLTTSDARPSVDWF*SNKSTHPITGQSSD 204 DS S RPS+DWF N+S + + SS+ Sbjct: 223 DSDLSFVSSDRPSMDWFEDNRSNYATSSSSSE 254 >At3g52160.1 68416.m05726 beta-ketoacyl-CoA synthase family protein beta-ketoacyl-CoA synthase - Simmondsia chinensis,PID:g1045614 Length = 451 Score = 28.7 bits (61), Expect = 5.7 Identities = 11/27 (40%), Positives = 18/27 (66%) Frame = +1 Query: 382 RAKAGLIQMFSTHRDCESTAYRSFSIK 462 RAK L+Q+ TH+ E T+Y+S ++ Sbjct: 291 RAKYQLMQLVRTHKGMEDTSYKSIELR 317 >At4g38560.1 68417.m05459 expressed protein Length = 521 Score = 27.9 bits (59), Expect = 10.0 Identities = 15/48 (31%), Positives = 25/48 (52%) Frame = +3 Query: 51 SYMLVSKIKPCMSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILEL 194 SY + + + + + GD A+GS Q +SYS+ + V+LEL Sbjct: 341 SYKVRASVSSTLQKILDKHGDIASGSKLQSLRTKSYSLETLAAVVLEL 388 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,788,013 Number of Sequences: 28952 Number of extensions: 255946 Number of successful extensions: 439 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 435 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 439 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2178500352 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -