BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_G20 (858 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.06 |||mitochondrial DNA binding endonuclease|Schizosacchar... 38 0.002 SPAC3G9.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||... 30 0.48 SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces po... 28 1.5 SPBP23A10.13 |orc4|orp4|origin recognition complex subunit Orc4|... 27 3.4 SPAC14C4.11 |||polyphosphate synthetase |Schizosaccharomyces pom... 26 6.0 SPBC29A3.14c |trt1||telomerase reverse transcriptase 1 protein T... 26 7.9 >SPMIT.06 |||mitochondrial DNA binding endonuclease|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 807 Score = 37.5 bits (83), Expect = 0.002 Identities = 24/76 (31%), Positives = 40/76 (52%) Frame = +2 Query: 245 DIAKAFDKVWHNGLIYKLYNIGVPDRLVLIIRDYLSNRSFRYRVEGTRSRPRHVTAGVPQ 424 DI FD + H+ LI L + R + +IR L N + T +R ++ G PQ Sbjct: 370 DIKACFDSIPHDKLIALLSSKIKDQRFIQLIRKAL-NAGYL-----TENRYKYDIVGTPQ 423 Query: 425 GSALSPLLFSLYINDI 472 GS +SP+L ++Y++ + Sbjct: 424 GSIVSPILANIYLHQL 439 >SPAC3G9.01 |||sequence orphan|Schizosaccharomyces pombe|chr 1|||Manual Length = 462 Score = 29.9 bits (64), Expect = 0.48 Identities = 23/76 (30%), Positives = 32/76 (42%), Gaps = 1/76 (1%) Frame = +3 Query: 360 RSDIESRERVPGPVTSQPESRKAPPSPRYYSVCISTIYPGLRRPIW-RSSPMTPPSTTRV 536 ++D+ RVP P S + K+PPS I + P L+ P RSS +P T Sbjct: 184 KTDLGKPARVPSPKKSLSSTIKSPPSRVKLPTSILSKSPPLKVPNKNRSSTFSPLRTPTS 243 Query: 537 GRRRCFIDDFRPQLPP 584 + I D PP Sbjct: 244 SSKTFVIVDHSTPSPP 259 >SPCC553.03 |pex1||AAA family ATPase Pex1 |Schizosaccharomyces pombe|chr 3|||Manual Length = 937 Score = 28.3 bits (60), Expect = 1.5 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 596 FRKWRIDINPTKSTAVLFKRGRPPNTTLSIPLPTXRVNN 712 F+ W+ P+ S +L ++G PP + LS L ++ N Sbjct: 260 FQIWKAHNPPSSSKFILEQKGLPPESNLSSELVAAKLKN 298 >SPBP23A10.13 |orc4|orp4|origin recognition complex subunit Orc4|Schizosaccharomyces pombe|chr 2|||Manual Length = 972 Score = 27.1 bits (57), Expect = 3.4 Identities = 17/52 (32%), Positives = 23/52 (44%) Frame = +3 Query: 369 IESRERVPGPVTSQPESRKAPPSPRYYSVCISTIYPGLRRPIWRSSPMTPPS 524 + +++R P+ P R PP R + I I PGL SS TP S Sbjct: 413 LNNQQRESAPLL--PRKRGRPPKKRQENAEIRNITPGLTDSSVHSSSATPQS 462 >SPAC14C4.11 |||polyphosphate synthetase |Schizosaccharomyces pombe|chr 1|||Manual Length = 734 Score = 26.2 bits (55), Expect = 6.0 Identities = 9/18 (50%), Positives = 13/18 (72%) Frame = -3 Query: 355 VRQVVSYDEHEPVWHSNV 302 +R+ V YDE EP+W S + Sbjct: 436 IRECVRYDEDEPLWISEL 453 >SPBC29A3.14c |trt1||telomerase reverse transcriptase 1 protein Trt1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 988 Score = 25.8 bits (54), Expect = 7.9 Identities = 10/20 (50%), Positives = 13/20 (65%) Frame = +2 Query: 413 GVPQGSALSPLLFSLYINDI 472 G+PQGS LS L Y+ D+ Sbjct: 703 GIPQGSILSSFLCHFYMEDL 722 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,577,249 Number of Sequences: 5004 Number of extensions: 80889 Number of successful extensions: 267 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 253 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 267 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 426466470 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -