BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_G08 (856 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 03_05_0183 - 21681673-21682524 29 4.7 08_02_1410 - 26876243-26876497,26877129-26877239,26877240-268773... 28 8.3 >03_05_0183 - 21681673-21682524 Length = 283 Score = 29.1 bits (62), Expect = 4.7 Identities = 12/27 (44%), Positives = 18/27 (66%) Frame = +2 Query: 581 SQAFIATLLFDPSMSALPIIAKQNSPS 661 SQAF A LL D + +A+P++ Q P+ Sbjct: 229 SQAFSAVLLADANRAAIPVVVVQKRPA 255 >08_02_1410 - 26876243-26876497,26877129-26877239,26877240-26877324, 26877620-26877672,26878318-26878440,26878514-26878597, 26878708-26878773,26879512-26879584,26879854-26879888, 26879970-26880212 Length = 375 Score = 28.3 bits (60), Expect = 8.3 Identities = 14/39 (35%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +1 Query: 10 LNTITP-YERFYARCGATF*FSS*RKRELPGLILPVVIC 123 +++I P YE Y+R G +++ R RELP + + V C Sbjct: 255 VSSILPFYEGLYSRWGGIMRYNTSRYRELPHISIKCVFC 293 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,087,516 Number of Sequences: 37544 Number of extensions: 435894 Number of successful extensions: 868 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 868 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2385713652 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -