BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_G06 (888 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_06_0456 + 29521282-29522064 30 2.1 06_03_0854 + 25400855-25403741,25406174-25407708 29 4.9 03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399 29 4.9 06_03_1448 + 30235336-30236763 29 6.5 06_03_1443 + 30182018-30183445 29 6.5 06_03_1440 + 30166515-30167942 29 6.5 06_03_1437 + 30151030-30152457 29 6.5 06_03_1429 + 30100834-30102261 29 6.5 06_03_1425 + 30084383-30085810 29 6.5 06_03_1420 - 30053713-30055140 29 6.5 06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764 29 6.5 02_04_0453 + 23053621-23054167,23054867-23054958,23055085-230551... 29 6.5 01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742... 29 6.5 03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384... 28 8.6 >01_06_0456 + 29521282-29522064 Length = 260 Score = 30.3 bits (65), Expect = 2.1 Identities = 18/46 (39%), Positives = 25/46 (54%), Gaps = 6/46 (13%) Frame = -2 Query: 374 WQC--PRTGSRGSFKRRRAFPPRHHSARLER----NTVRPPILSTA 255 W+C P +G+RG +RRR P S R R +T+RP + S A Sbjct: 13 WRCYSPASGARGGSRRRRRRPAGTTSRRCSRADRLDTLRPYVTSAA 58 >06_03_0854 + 25400855-25403741,25406174-25407708 Length = 1473 Score = 29.1 bits (62), Expect = 4.9 Identities = 15/42 (35%), Positives = 23/42 (54%) Frame = -2 Query: 188 AKRSPTHATPLMSPYNARLESSSTGSSFPADSPKPVPLAVVS 63 AKR+PT T P AR +++ +F +P P P +V+S Sbjct: 475 AKRAPTAVTVGAPPPQARTPAAAPAKAF-VSAPAPAPSSVIS 515 >03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399 Length = 146 Score = 29.1 bits (62), Expect = 4.9 Identities = 21/67 (31%), Positives = 30/67 (44%) Frame = +1 Query: 277 RTVFRSKRAEW*RGGNARRRLKLPRDPVRGHCQVGSLTGAVHLSKNNAGVLRPAQRGQKP 456 R + +R E G +RR L D +RG+ + A H AG + RG KP Sbjct: 59 RCIAEGRREEEEEVGRSRRGKDLDLDDMRGYGET-----ATHHGLRLAGREEVSPRGGKP 113 Query: 457 RVEQKGK 477 RV+ G+ Sbjct: 114 RVDNGGR 120 >06_03_1448 + 30235336-30236763 Length = 475 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 382 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 245 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1443 + 30182018-30183445 Length = 475 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 382 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 245 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1440 + 30166515-30167942 Length = 475 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 382 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 245 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1437 + 30151030-30152457 Length = 475 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 382 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 245 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1429 + 30100834-30102261 Length = 475 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 382 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 245 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1425 + 30084383-30085810 Length = 475 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 382 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 245 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_03_1420 - 30053713-30055140 Length = 475 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = -3 Query: 382 SPPGSVLEPDHAGVLN-GDERFRHVTTLHAWNETPCARRYYRPRTAS 245 +PP L +L+ GD+R+ V LH W+E R YR +S Sbjct: 126 NPPPPTLGDHQLAILSCGDDRYV-VAALHVWSEFTSTLRLYRSSCSS 171 >06_01_0328 + 2379610-2380359,2380479-2381108,2381222-2381764 Length = 640 Score = 28.7 bits (61), Expect = 6.5 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -3 Query: 310 TTLHAWNETPCARRYY 263 TT AW ETPCA R++ Sbjct: 560 TTTEAWVETPCAHRFH 575 >02_04_0453 + 23053621-23054167,23054867-23054958,23055085-23055149, 23058558-23059086 Length = 410 Score = 28.7 bits (61), Expect = 6.5 Identities = 16/43 (37%), Positives = 21/43 (48%) Frame = -2 Query: 677 NLLRNDRKSRHRRIKKATSL*TLGCHKPVIPVVTFLAPLAKNS 549 N N K R + KATS +L C K I + F PL+ +S Sbjct: 73 NACENKEKRRKMMVAKATSPSSLDCPKLGILIEPFFIPLSSSS 115 >01_06_1406 - 37073548-37073822,37073892-37074111,37074200-37074246, 37074404-37074576,37075161-37075238,37075751-37075813, 37075889-37075961,37076150-37076189,37076302-37076368, 37076719-37078472,37079128-37079230,37080041-37080078, 37080221-37080347,37081944-37082152 Length = 1088 Score = 28.7 bits (61), Expect = 6.5 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +3 Query: 318 RKRSSPFKTPA*SGSRTLPGGEFDWGGTSV 407 +KR P K PA S S+ LPG + + G SV Sbjct: 339 KKRGRPRKYPAPSNSKHLPGTDTELGNDSV 368 >03_02_0740 - 10836752-10837052,10837756-10837814,10837901-10838476, 10839965-10841686,10841776-10842173,10842264-10842318, 10842989-10843048,10843444-10843540,10844885-10844955, 10845029-10845109,10846054-10846124,10847951-10848119, 10848521-10848683,10848752-10848942,10849037-10849168 Length = 1381 Score = 28.3 bits (60), Expect = 8.6 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -3 Query: 397 PPQSNSPPGSVLEPDHAGVLNGDE 326 P +NS P +V +PD +LNGDE Sbjct: 739 PTSNNSVPQNVDQPDSKKMLNGDE 762 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,934,925 Number of Sequences: 37544 Number of extensions: 529284 Number of successful extensions: 1666 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1592 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1664 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 2495239620 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -