BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_F22 (849 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like pr... 22 5.3 AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. 21 9.3 >AF356647-1|AAK43700.1| 1156|Tribolium castaneum teashirt-like protein protein. Length = 1156 Score = 22.2 bits (45), Expect = 5.3 Identities = 8/25 (32%), Positives = 14/25 (56%) Frame = +3 Query: 15 EADVIGIHKPGKPTNETSSYRPVSL 89 ++DV+ + KPG P + P+ L Sbjct: 220 DSDVVNLSKPGTPPSGEPGNGPLDL 244 Score = 22.2 bits (45), Expect = 5.3 Identities = 14/48 (29%), Positives = 20/48 (41%) Frame = -3 Query: 496 NSNGESAEPCGTPAVS*RGRERVPSTRYRNERFDKKSRMMSTSLSGTP 353 +SNG E P+VS R P+ + + S+ SGTP Sbjct: 899 HSNGAKEEDEDKPSVSPLTSPRQPAETHAGSPCRNSASPASSDRSGTP 946 >AJ307577-1|CAC84070.1| 301|Tribolium castaneum dachshund protein. Length = 301 Score = 21.4 bits (43), Expect = 9.3 Identities = 10/21 (47%), Positives = 12/21 (57%) Frame = -3 Query: 322 CQTLSNAFAMSKKRAPVGICL 260 C T S+ KRAPVG+ L Sbjct: 31 CTTASSWPGRPPKRAPVGLSL 51 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 185,793 Number of Sequences: 336 Number of extensions: 4192 Number of successful extensions: 7 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 7 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23451794 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -