BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_F20 (767 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0281 + 11560402-11560569,11561373-11561579,11562966-115631... 29 5.4 08_02_1268 - 25751744-25752637 28 9.4 >05_03_0281 + 11560402-11560569,11561373-11561579,11562966-11563174, 11563261-11563309,11563611-11563673,11563799-11565472 Length = 789 Score = 28.7 bits (61), Expect = 5.4 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 2/35 (5%) Frame = -2 Query: 295 CRSNSFGDLPVFARWTRTHXNVSMSQMQ--GQVDY 197 CRS+ +GD ++ +R H + + Q Q GQ DY Sbjct: 169 CRSSFYGDNELYTHMSREHYSCHICQRQHPGQYDY 203 >08_02_1268 - 25751744-25752637 Length = 297 Score = 27.9 bits (59), Expect = 9.4 Identities = 17/48 (35%), Positives = 23/48 (47%) Frame = +3 Query: 336 LAGVLGTLVEA*RGTAKRGCNHRRGTTLSAPVYLITAPSPGIKRLDIS 479 LA G +A GT ++ C+ R TT+ Y + PG LDIS Sbjct: 36 LAIYWGRHADADEGTLRQACDTGRYTTVIITFYNVFGYHPGNYNLDIS 83 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,694,208 Number of Sequences: 37544 Number of extensions: 412998 Number of successful extensions: 1326 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 1281 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1326 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2063219900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -