BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_F19 (862 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_07_0197 + 41912207-41912652,41913226-41913800,41913828-419157... 31 1.2 >01_07_0197 + 41912207-41912652,41913226-41913800,41913828-41915748, 41915836-41916049,41916143-41916394,41916469-41916528, 41916646-41916776,41916898-41917012,41917084-41917239 Length = 1289 Score = 31.1 bits (67), Expect = 1.2 Identities = 19/40 (47%), Positives = 24/40 (60%), Gaps = 1/40 (2%) Frame = +1 Query: 529 YKEFLARG-ARKVTTGITGLWQPSVHSDVAF*SFHVGLXL 645 YK F A G RKV GIT + PS+ D+AF S +G+ L Sbjct: 633 YKIFQAFGLVRKVEKGITRWYYPSMLDDLAFDSAALGIAL 672 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 19,869,376 Number of Sequences: 37544 Number of extensions: 356210 Number of successful extensions: 619 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 607 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 619 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2409218220 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -