BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_F19 (862 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 24 1.6 DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholi... 24 2.1 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 4.8 AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic ac... 22 6.3 DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholi... 22 8.4 DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholi... 22 8.4 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 24.2 bits (50), Expect = 1.6 Identities = 11/28 (39%), Positives = 14/28 (50%) Frame = -1 Query: 676 NGWRNFASPMIGRARHGRIKKQRRYERL 593 N +RN R R KK RRY++L Sbjct: 243 NSYRNDGERSCSRDRSREYKKDRRYDQL 270 >DQ026032-1|AAY87891.1| 566|Apis mellifera nicotinic acetylcholine receptor alpha3subunit protein. Length = 566 Score = 23.8 bits (49), Expect = 2.1 Identities = 11/22 (50%), Positives = 14/22 (63%) Frame = +3 Query: 348 PKSLILMNLDNFCRSHGQVPAT 413 P+ L +NL + CR HG PAT Sbjct: 430 PRELEAVNLGSACRIHGS-PAT 450 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 22.6 bits (46), Expect = 4.8 Identities = 15/45 (33%), Positives = 20/45 (44%) Frame = +1 Query: 157 MSQCKPY*GDTANGSIYQFWFLRSYSVTWITVVILELIHAIRTLT 291 M C P DT +Y+F R Y + T VI + + TLT Sbjct: 230 MYACCP--NDTYPMIVYEFSISRHYGILHATYVIPAVTMMLLTLT 272 >AY540846-1|AAS48080.1| 541|Apis mellifera neuronal nicotinic acetylcholine receptorApisa2 subunit protein. Length = 541 Score = 22.2 bits (45), Expect = 6.3 Identities = 10/38 (26%), Positives = 19/38 (50%) Frame = +3 Query: 129 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 242 Y C + + LRR + ++++VP + +SYL Sbjct: 215 YPCCDEPYPDIFFNITLRRKTLFYTVNLIVPCVSISYL 252 >DQ026034-1|AAY87893.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 8.4 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +3 Query: 129 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 242 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 >DQ026033-1|AAY87892.1| 569|Apis mellifera nicotinic acetylcholine receptor alpha4subunit protein. Length = 569 Score = 21.8 bits (44), Expect = 8.4 Identities = 7/38 (18%), Positives = 21/38 (55%) Frame = +3 Query: 129 YACLKD*AMHVSVQAVLRRYREWLNISVLVP*ILLSYL 242 Y C + + ++ +RR + +++++P + +S+L Sbjct: 224 YTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFL 261 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 201,219 Number of Sequences: 438 Number of extensions: 3855 Number of successful extensions: 8 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 27795333 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -