BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_F15 (849 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosa... 27 3.4 SPBC1711.10c |npl4||Cdc48-Ufd1-Npl4 complex component Npl4 |Schi... 27 3.4 SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr... 26 7.8 >SPAC637.08 |||iron-sulfur cluster assembly ATPase Nbp35|Schizosaccharomyces pombe|chr 1|||Manual Length = 317 Score = 27.1 bits (57), Expect = 3.4 Identities = 16/47 (34%), Positives = 23/47 (48%), Gaps = 2/47 (4%) Frame = +3 Query: 555 YICQRITQVS*GQL--SEDRNLAWSKRAKAGLIXMFSTHRDCESTAY 689 Y+C + +S G L SED ++ W K GLI F + E+ Y Sbjct: 127 YVCPNLAVMSIGFLLPSEDSSVIWRGPKKNGLIKQFIKDVNWENLDY 173 >SPBC1711.10c |npl4||Cdc48-Ufd1-Npl4 complex component Npl4 |Schizosaccharomyces pombe|chr 2|||Manual Length = 545 Score = 27.1 bits (57), Expect = 3.4 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +1 Query: 4 CKTKHLRWPSRVLTQCDFLPSALNVNVKKFK 96 C + H WP+ + T+C PS + +N++ F+ Sbjct: 209 CPSGHPPWPAGICTKCQ--PSTVMLNLQPFR 237 >SPAC56F8.02 |||AMP binding enzyme |Schizosaccharomyces pombe|chr 1|||Manual Length = 1517 Score = 25.8 bits (54), Expect = 7.8 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -1 Query: 672 SPYAY*TXGSSQLLPFCSTRGF 607 SPYA+ T S+ L PF STR + Sbjct: 1211 SPYAFSTVYSNCLNPFISTRSY 1232 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 3,205,405 Number of Sequences: 5004 Number of extensions: 65830 Number of successful extensions: 162 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 156 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 162 length of database: 2,362,478 effective HSP length: 72 effective length of database: 2,002,190 effective search space used: 420459900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -