BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_F03 (850 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 05_03_0366 - 13102147-13102281,13102560-13102739,13102791-131029... 34 0.16 07_03_1747 + 29188568-29188715,29188793-29189541 31 1.5 12_01_0524 - 4167867-4168445 29 3.5 04_01_0530 - 6928528-6929500,6929514-6930964 28 8.2 02_01_0296 + 1978565-1981197,1981216-1981639,1982280-1982771,198... 28 8.2 01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668,298... 28 8.2 >05_03_0366 - 13102147-13102281,13102560-13102739,13102791-13102992, 13104385-13104575 Length = 235 Score = 33.9 bits (74), Expect = 0.16 Identities = 22/56 (39%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = -1 Query: 343 HQPSAAAPLPCVPTQSFVDPIHLKICLYSHGGLGLTNVSMSQM-QGQVDYDFGVGG 179 H P AAA P VP++ P L + S GG GL S S + G + D G+GG Sbjct: 7 HSPRAAAAAPSVPSR-LPRPFLLSLSSPSRGGSGLVAASASAVAAGGSEGDGGIGG 61 >07_03_1747 + 29188568-29188715,29188793-29189541 Length = 298 Score = 30.7 bits (66), Expect = 1.5 Identities = 19/51 (37%), Positives = 27/51 (52%) Frame = +3 Query: 396 PPPGTTLSAPVYLITAPSPG*SAWTLALQFLCS*TIGPTTCRLARSSSVLG 548 PPP TT++ V L TA + S + QF+C+ TTC + S S+ G Sbjct: 213 PPPTTTMAQHVVLPTAAA---SCHQMQDQFVCARAAETTTCCWSESESLPG 260 >12_01_0524 - 4167867-4168445 Length = 192 Score = 29.5 bits (63), Expect = 3.5 Identities = 22/72 (30%), Positives = 32/72 (44%) Frame = -1 Query: 340 QPSAAAPLPCVPTQSFVDPIHLKICLYSHGGLGLTNVSMSQMQGQVDYDFGVGGGVPIVR 161 QPS+AA P + + + + YSH G + S + G + G GGG P V Sbjct: 104 QPSSAAVAPLPSSTNLKSAVRSAMGSYSHSGTRRVHFGDSTVLG--EKAAGAGGGEPAV- 160 Query: 160 CEERVDHEGQ*C 125 EE + E + C Sbjct: 161 VEEVEEEEEKEC 172 >04_01_0530 - 6928528-6929500,6929514-6930964 Length = 807 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/47 (34%), Positives = 27/47 (57%) Frame = +1 Query: 76 VSPHLCYS*CGRMRKRNITVPHDRLAPRNVRSGLPPRLQNRSQPDPA 216 +SP+LCY+ C RK+ +L+ + SGLPP++ S+ + A Sbjct: 475 LSPNLCYAFCITSRKKT------QLSQPSNNSGLPPKIFTYSELEKA 515 >02_01_0296 + 1978565-1981197,1981216-1981639,1982280-1982771, 1982950-1983087 Length = 1228 Score = 28.3 bits (60), Expect = 8.2 Identities = 13/29 (44%), Positives = 17/29 (58%) Frame = -3 Query: 425 GRGERSPRRWLQPRLAVPRQASTSVPRTP 339 GRG RS R L+P LA+ A + +P P Sbjct: 442 GRGPRSTLRILRPGLAISEMARSMLPAEP 470 >01_01_0386 - 2985563-2985986,2986301-2986390,2986529-2986668, 2986798-2986893,2987003-2987042,2987760-2987887 Length = 305 Score = 28.3 bits (60), Expect = 8.2 Identities = 15/41 (36%), Positives = 22/41 (53%) Frame = -3 Query: 422 RGERSPRRWLQPRLAVPRQASTSVPRTPAKCCSPTPLRSNS 300 R RSPRR P R + + R+PA S +P+R++S Sbjct: 224 RDSRSPRRSASPPNGRNRSPTPNASRSPAPRDSRSPMRADS 264 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,826,276 Number of Sequences: 37544 Number of extensions: 507419 Number of successful extensions: 1570 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 1507 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1568 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2362209084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -