BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_F01 (904 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) 38 0.011 SB_53920| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.015 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 36 0.045 SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) 36 0.059 SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.059 SB_5869| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.078 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.10 SB_26704| Best HMM Match : bZIP_2 (HMM E-Value=1.6) 35 0.10 SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.14 SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.18 SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) 33 0.24 SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_33599| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_28913| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_25836| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) 33 0.42 SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 33 0.42 SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) 33 0.42 SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_54473| Best HMM Match : DLIC (HMM E-Value=0) 33 0.42 SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) 33 0.42 SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) 33 0.42 SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) 33 0.42 SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 33 0.42 SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) 33 0.42 SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) 33 0.42 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) 33 0.42 SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 33 0.42 SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) 33 0.42 SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) 33 0.42 SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) 33 0.42 SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) 33 0.42 SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) 33 0.42 SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) 33 0.42 SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) 33 0.42 SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) 33 0.42 SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) 33 0.42 SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) 33 0.42 SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) 33 0.42 SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) 33 0.42 SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) 33 0.42 SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) 33 0.42 SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_30578| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_30418| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_30415| Best HMM Match : M (HMM E-Value=6.5e-05) 33 0.42 SB_30336| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_30025| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_29954| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_29871| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_29445| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_29341| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_29332| Best HMM Match : PAN (HMM E-Value=0.039) 33 0.42 SB_29285| Best HMM Match : DUF1201 (HMM E-Value=2.4) 33 0.42 SB_29217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_29207| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_29039| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_29037| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_28940| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_28825| Best HMM Match : COX8 (HMM E-Value=4.5) 33 0.42 SB_28646| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_28582| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_28530| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_28324| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_28283| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_28216| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_28148| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_28014| Best HMM Match : HOOK (HMM E-Value=1.8e-13) 33 0.42 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_27823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_27762| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_27362| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_27108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_26464| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_26380| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_26309| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_25891| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_25680| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_25598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_25575| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_25523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_25409| Best HMM Match : PSD1 (HMM E-Value=7.2) 33 0.42 SB_25166| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_24903| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_24822| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_24636| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_24611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_24484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_24337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_24316| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_23912| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_23614| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_23442| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_23287| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_23160| Best HMM Match : DUF1136 (HMM E-Value=9.6) 33 0.42 SB_23047| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_22452| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_22432| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_22377| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_22217| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_22126| Best HMM Match : Glyco_transf_10 (HMM E-Value=1.9) 33 0.42 SB_22074| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_21996| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_21918| Best HMM Match : STT3 (HMM E-Value=0) 33 0.42 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_21573| Best HMM Match : WD40 (HMM E-Value=4.1e-32) 33 0.42 SB_21569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_21560| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 33 0.42 SB_21293| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_20931| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_20710| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_20660| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_20556| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_20437| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_20337| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_20335| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_20328| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_20204| Best HMM Match : UCR_TM (HMM E-Value=9.9) 33 0.42 SB_20039| Best HMM Match : LRR_1 (HMM E-Value=0.0061) 33 0.42 SB_19740| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_19737| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_19732| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_19598| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_19569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_19301| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_19273| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_18823| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_18484| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 33 0.42 SB_17987| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_17701| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_17561| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_17455| Best HMM Match : Ank (HMM E-Value=2.2) 33 0.42 SB_17363| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_17297| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_17013| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_16390| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 33 0.42 SB_16122| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_15961| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_15827| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_15736| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_15700| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_15611| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_15584| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_15441| Best HMM Match : RVT_1 (HMM E-Value=1e-19) 33 0.42 SB_15339| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_15306| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_15122| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_14916| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_14827| Best HMM Match : Neur_chan_LBD (HMM E-Value=3.8) 33 0.42 SB_14529| Best HMM Match : S10_plectin (HMM E-Value=5.8) 33 0.42 SB_14523| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_14253| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_14086| Best HMM Match : POR (HMM E-Value=7.7) 33 0.42 SB_13840| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13737| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13728| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13672| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13641| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13401| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13399| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13329| Best HMM Match : C1_2 (HMM E-Value=7.3) 33 0.42 SB_13203| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13197| Best HMM Match : DUF765 (HMM E-Value=5.8) 33 0.42 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13059| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_13008| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_12959| Best HMM Match : Peptidase_M16_C (HMM E-Value=1e-14) 33 0.42 SB_12760| Best HMM Match : DUF765 (HMM E-Value=6.2) 33 0.42 SB_12705| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_12508| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_12310| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_12176| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_12153| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_11959| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_11796| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_11690| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_11081| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_11016| Best HMM Match : DUF726 (HMM E-Value=1.3e-08) 33 0.42 SB_10906| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_10608| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_10567| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_10507| Best HMM Match : 7tm_1 (HMM E-Value=7.9e-09) 33 0.42 SB_10491| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_10425| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_9985| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_9919| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_8996| Best HMM Match : DUF765 (HMM E-Value=7.2) 33 0.42 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_8846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 33 0.42 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_8191| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_8043| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7929| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7925| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7839| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7837| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7679| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7552| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7446| Best HMM Match : SH2 (HMM E-Value=2.7e-22) 33 0.42 SB_7340| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7304| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7279| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7158| Best HMM Match : Copper-fist (HMM E-Value=7.1) 33 0.42 SB_7027| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_6958| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_6846| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_6413| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_6345| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_5250| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_5084| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_4603| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_4586| Best HMM Match : DUF765 (HMM E-Value=7) 33 0.42 SB_4554| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_4437| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_4385| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_4363| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_4332| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_4105| Best HMM Match : WAP (HMM E-Value=0.0002) 33 0.42 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 33 0.42 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_3420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_3391| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_3149| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_3059| Best HMM Match : REJ (HMM E-Value=4.8e-06) 33 0.42 SB_2915| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_2869| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_2377| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_2289| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_2195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_2177| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_2138| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_1887| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_1540| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_1459| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_1420| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_1407| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_1195| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_1055| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_931| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_753| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_741| Best HMM Match : Agenet (HMM E-Value=7.4) 33 0.42 SB_740| Best HMM Match : DUF1131 (HMM E-Value=4.8) 33 0.42 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_318| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_278| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59788| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59734| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59691| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59574| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59569| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59539| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59521| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59510| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59292| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_59178| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58804| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58800| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58763| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58688| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58686| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58626| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 SB_58592| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.42 >SB_26735| Best HMM Match : rve (HMM E-Value=0.00066) Length = 333 Score = 37.9 bits (84), Expect = 0.011 Identities = 23/54 (42%), Positives = 29/54 (53%), Gaps = 3/54 (5%) Frame = +2 Query: 419 LELQVAAALEYPSRGPSL---RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 + ++ A+ EY S G L R P + PYSESYY + LQRRDWEN Sbjct: 202 VRVKTASGAEYQSPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 253 >SB_53920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 37.5 bits (83), Expect = 0.015 Identities = 24/56 (42%), Positives = 29/56 (51%), Gaps = 1/56 (1%) Frame = +2 Query: 407 WHHVLELQVAAALEYPSRGPSL-RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 W + L+VA A + P L R P + PYSESYY + LQRRDWEN Sbjct: 49 WTSLFALKVAHATKSPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 102 >SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) Length = 783 Score = 35.9 bits (79), Expect = 0.045 Identities = 21/49 (42%), Positives = 26/49 (53%), Gaps = 1/49 (2%) Frame = +2 Query: 428 QVAAALEYPSRGPSL-RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 ++ +EYP L R P + PYSESYY + LQRRDWEN Sbjct: 521 EIIIVMEYPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 567 >SB_38675| Best HMM Match : HEAT (HMM E-Value=0.0016) Length = 606 Score = 35.5 bits (78), Expect = 0.059 Identities = 32/80 (40%), Positives = 37/80 (46%), Gaps = 3/80 (3%) Frame = +2 Query: 341 ALISDRECPQLQAGAARLPPAQWHHVLELQVAAALEYPSRGPSL---RVPSFLVQSGPYS 511 ALI +R + Q R Q H +LE A A S G L R P + PYS Sbjct: 452 ALIENRIDRKSQDALDRRRYIQAHPILE---AGASNSCSPGDPLVLERPPPRWSSNSPYS 508 Query: 512 ESYYXLGTGPSFLQRRDWEN 571 ESYY + LQRRDWEN Sbjct: 509 ESYY--NSLAVVLQRRDWEN 526 >SB_15853| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 35.5 bits (78), Expect = 0.059 Identities = 25/65 (38%), Positives = 33/65 (50%), Gaps = 5/65 (7%) Frame = +2 Query: 392 LPPAQWHHVLELQVAAALEYPSRGPS-----LRVPSFLVQSGPYSESYYXLGTGPSFLQR 556 LP A +L + +A++ + P R P R P + PYSESYY + LQR Sbjct: 6 LPRALSLPLLSIFLASSRKSPPRSPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQR 63 Query: 557 RDWEN 571 RDWEN Sbjct: 64 RDWEN 68 >SB_5869| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1017 Score = 35.1 bits (77), Expect = 0.078 Identities = 24/56 (42%), Positives = 28/56 (50%), Gaps = 1/56 (1%) Frame = +2 Query: 407 WHHVLELQVAAALEYPSRGPSL-RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 W H+ L +A E P L R P + PYSESYY + LQRRDWEN Sbjct: 5 WGHLFSL-LAERPEVPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 57 >SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 34.7 bits (76), Expect = 0.10 Identities = 17/41 (41%), Positives = 23/41 (56%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWENXXLGIFVK 595 R P + PYSESYY + LQRRDWEN + + ++ Sbjct: 523 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWENTGVSLVIR 561 >SB_26704| Best HMM Match : bZIP_2 (HMM E-Value=1.6) Length = 335 Score = 34.7 bits (76), Expect = 0.10 Identities = 23/52 (44%), Positives = 27/52 (51%), Gaps = 1/52 (1%) Frame = +2 Query: 419 LELQVAAALEYPSRGPSL-RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 LE ++ A E S L R P + PYSESYY + LQRRDWEN Sbjct: 206 LEFRIKQATERKSSIEVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 255 >SB_20759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 34.3 bits (75), Expect = 0.14 Identities = 22/59 (37%), Positives = 28/59 (47%), Gaps = 5/59 (8%) Frame = +2 Query: 410 HHVLELQVAAALEYPSRGPS-----LRVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 H V++ + + RGP R P + PYSESYY + LQRRDWEN Sbjct: 14 HFVIDFLSIEMIRFLFRGPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 70 >SB_35112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 33.9 bits (74), Expect = 0.18 Identities = 24/60 (40%), Positives = 29/60 (48%), Gaps = 3/60 (5%) Frame = +2 Query: 401 AQWHHVLELQVAAALEYPSRGPSL---RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 A W H E++ + S G L R P + PYSESYY + LQRRDWEN Sbjct: 6 ACWAHNPEVRGSKPSNSCSPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 63 >SB_29318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.9 bits (74), Expect = 0.18 Identities = 29/66 (43%), Positives = 32/66 (48%), Gaps = 3/66 (4%) Frame = +2 Query: 383 AARLPPAQWHHVLELQVAAALEYPSRGPSL---RVPSFLVQSGPYSESYYXLGTGPSFLQ 553 AA L PA +E Q AA S G L R P + PYSESYY + LQ Sbjct: 9 AAVLTPAP----VERQHVAASNSCSPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQ 62 Query: 554 RRDWEN 571 RRDWEN Sbjct: 63 RRDWEN 68 >SB_30576| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 33.5 bits (73), Expect = 0.24 Identities = 21/43 (48%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = +2 Query: 452 PSRGPSL---RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 PS G L R P + PYSESYY + LQRRDWEN Sbjct: 36 PSPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 76 >SB_15593| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1593 Score = 33.5 bits (73), Expect = 0.24 Identities = 19/43 (44%), Positives = 23/43 (53%) Frame = +2 Query: 443 LEYPSRGPSLRVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 ++ P R R P + PYSESYY + LQRRDWEN Sbjct: 139 IKKPLRSFLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 179 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 29 RAPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 59 >SB_50382| Best HMM Match : RVT_1 (HMM E-Value=0.026) Length = 1036 Score = 33.5 bits (73), Expect = 0.24 Identities = 21/44 (47%), Positives = 23/44 (52%), Gaps = 1/44 (2%) Frame = +2 Query: 443 LEYPSRGPSL-RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 L YP L R P + PYSESYY + LQRRDWEN Sbjct: 112 LHYPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 153 >SB_36181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 19 RTPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 49 >SB_34430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 36 RAPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 66 >SB_33599| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 33.5 bits (73), Expect = 0.24 Identities = 21/43 (48%), Positives = 23/43 (53%), Gaps = 3/43 (6%) Frame = +2 Query: 452 PSRGPSL---RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 PS G L R P + PYSESYY + LQRRDWEN Sbjct: 15 PSPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 55 >SB_23203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 33.5 bits (73), Expect = 0.24 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 16 RPPPRWSSNSPYSESYY--NSPAVVLQRRDWEN 46 >SB_47480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 167 Score = 33.1 bits (72), Expect = 0.32 Identities = 22/46 (47%), Positives = 24/46 (52%), Gaps = 1/46 (2%) Frame = +2 Query: 437 AALEYPSRGPSL-RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 A LE P L R P + PYSESYY + LQRRDWEN Sbjct: 44 ARLESPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 87 >SB_29521| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 33.1 bits (72), Expect = 0.32 Identities = 21/45 (46%), Positives = 24/45 (53%), Gaps = 1/45 (2%) Frame = +2 Query: 440 ALEYPSRGPSL-RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 A E+P L R P + PYSESYY + LQRRDWEN Sbjct: 54 ASEFPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 96 >SB_2426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 33.1 bits (72), Expect = 0.32 Identities = 22/56 (39%), Positives = 27/56 (48%), Gaps = 3/56 (5%) Frame = +2 Query: 413 HVLELQVAAALEYPSRGPSL---RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 HV+ + + S G L R P + PYSESYY + LQRRDWEN Sbjct: 15 HVVYINIIRQSNSCSPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 68 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 33.1 bits (72), Expect = 0.32 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 78 RPPPRWSSNSPYSESYY--NSLAVILQRRDWEN 108 >SB_28913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 33.1 bits (72), Expect = 0.32 Identities = 23/56 (41%), Positives = 26/56 (46%), Gaps = 1/56 (1%) Frame = +2 Query: 407 WHHVLELQVAAALEYPSRGPSL-RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 W E + A E P L R P + PYSESYY + LQRRDWEN Sbjct: 62 WSDSQEDRFEIAAESPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 115 >SB_25836| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 33.1 bits (72), Expect = 0.32 Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 2/50 (4%) Frame = +2 Query: 428 QVAAALEYPSRGPSL--RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 ++ +L P P + R P + PYSESYY + LQRRDWEN Sbjct: 22 ELRTSLPSPGGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 69 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 33.1 bits (72), Expect = 0.32 Identities = 22/53 (41%), Positives = 26/53 (49%), Gaps = 3/53 (5%) Frame = +2 Query: 422 ELQVAAALEYPSRGPSL---RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 E ++ A S G L R P + PYSESYY + LQRRDWEN Sbjct: 4 EFRITAVSNSCSPGDPLVLERPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 54 >SB_59635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_59604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 25 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 55 >SB_59460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 23 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 53 >SB_59373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 48 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 78 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 39 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 69 >SB_58779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_58736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 16 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 46 >SB_58703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 31 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 61 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 40 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 70 >SB_58509| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 21 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 51 >SB_58229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_58088| Best HMM Match : HLH (HMM E-Value=3e-12) Length = 297 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 197 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 227 >SB_58079| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 92 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 122 >SB_57850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_57778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 28 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 58 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 362 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 392 >SB_57711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_57403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_57318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 20 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 50 >SB_57204| Best HMM Match : DUF765 (HMM E-Value=9.1) Length = 129 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 19 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 49 >SB_57194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_57151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 26 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 56 >SB_57135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 431 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 321 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 351 >SB_57120| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 61 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 91 >SB_57084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 31 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 61 >SB_56982| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 40 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 70 >SB_56806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 24 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 54 >SB_56764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 225 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 115 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 145 >SB_56746| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 44 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 74 >SB_56737| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 20 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 50 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 48 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 78 >SB_56027| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_56013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 539 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 237 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 267 >SB_55981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_55938| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_55811| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 17 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 47 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 95 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 125 >SB_55320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 15 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 45 >SB_55155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 487 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 377 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 407 >SB_54989| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_54840| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 269 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 100 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 130 >SB_54473| Best HMM Match : DLIC (HMM E-Value=0) Length = 1401 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 395 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 425 >SB_54247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_54089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 37 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 67 >SB_54029| Best HMM Match : DUF765 (HMM E-Value=6.6) Length = 137 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 27 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 57 >SB_53988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_53666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_53407| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 35 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 65 >SB_53265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 44 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 74 >SB_53231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_53118| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_52844| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_52789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 300 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 166 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 196 >SB_52760| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 15 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 45 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 21 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 51 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 35 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 65 >SB_52493| Best HMM Match : DUF765 (HMM E-Value=9.6) Length = 142 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 32 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 62 >SB_52427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_52366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 16 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 46 >SB_52302| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 30 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 60 >SB_52283| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 20 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 50 >SB_52260| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_52161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 174 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 65 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 95 >SB_52086| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_51989| Best HMM Match : Extensin_2 (HMM E-Value=0.29) Length = 473 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 321 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 351 >SB_51855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_51409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_51320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 67 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 97 >SB_50900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 17 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 47 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 275 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 305 >SB_50524| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 38 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 68 >SB_50270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 857 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 392 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 422 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 32 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 62 >SB_50060| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 24 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 54 >SB_50043| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_49896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 74 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 104 >SB_49814| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 302 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 192 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 222 >SB_49788| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 24 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 54 >SB_49530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 24 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 54 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 32 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 62 >SB_49256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 26 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 56 >SB_49211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 16 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 46 >SB_49040| Best HMM Match : SlyX (HMM E-Value=7.1) Length = 286 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 176 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 206 >SB_49017| Best HMM Match : DUF765 (HMM E-Value=1.8) Length = 143 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 33 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 63 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 34 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 64 >SB_48514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 237 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 67 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 97 >SB_48486| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_48300| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_48217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 30 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 60 >SB_48129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_48100| Best HMM Match : Transformer (HMM E-Value=5.4) Length = 325 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 168 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 198 >SB_48063| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_48039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 48 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 78 >SB_48026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 31 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 61 >SB_47536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_47399| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_47315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 77 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 107 >SB_47208| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 30 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 60 >SB_46947| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_46889| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 754 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 644 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 674 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 29 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 59 >SB_46651| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 18 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 48 >SB_46517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_46424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_46361| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 17 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 47 >SB_46321| Best HMM Match : DUF765 (HMM E-Value=3.4) Length = 134 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 24 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 54 >SB_45923| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_45887| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_45068| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 61 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 91 >SB_44920| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 11 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 41 >SB_44900| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 26 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 56 >SB_44829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 236 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 126 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 156 >SB_44806| Best HMM Match : Hist_deacetyl (HMM E-Value=0) Length = 496 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 56 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 86 >SB_44800| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_44789| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_44778| Best HMM Match : TPR_2 (HMM E-Value=0.00023) Length = 1016 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 906 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 936 >SB_44516| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 27 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 57 >SB_44497| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 38 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 68 >SB_44466| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_44411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_44392| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_44312| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 27 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 57 >SB_44259| Best HMM Match : MORN (HMM E-Value=3.7) Length = 718 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 334 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 364 >SB_44013| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_43960| Best HMM Match : Toxin_19 (HMM E-Value=0.56) Length = 166 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 56 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 86 >SB_43909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_43618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_43510| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 217 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 107 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 137 >SB_43098| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 78 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 108 >SB_42937| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 35 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 65 >SB_42936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 85 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 115 >SB_42924| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 28 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 58 >SB_42730| Best HMM Match : Ank (HMM E-Value=0.00016) Length = 999 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 889 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 919 >SB_42646| Best HMM Match : DUF765 (HMM E-Value=5.8) Length = 130 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 20 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 50 >SB_42337| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 24 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 54 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 76 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 106 >SB_42015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 62 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 92 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 18 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 48 >SB_41779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 37 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 67 >SB_41568| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 31 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 61 >SB_41365| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 33 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 63 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 77 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 107 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 56 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 86 >SB_40862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 39 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 69 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 52 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 82 >SB_40583| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 28 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 58 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 34 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 64 >SB_40471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_40465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 37 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 67 >SB_40230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 203 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 93 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 123 >SB_40107| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 43 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 73 >SB_39690| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 54 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 84 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 16 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 46 >SB_39406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_39311| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 916 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 806 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 836 >SB_39280| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 53 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 83 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 38 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 68 >SB_39107| Best HMM Match : Lyase_8 (HMM E-Value=0.016) Length = 872 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 762 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 792 >SB_38948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 28 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 58 >SB_38893| Best HMM Match : UMPH-1 (HMM E-Value=2.3e-21) Length = 372 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 52 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 82 >SB_38767| Best HMM Match : Filamin (HMM E-Value=0.034) Length = 265 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 155 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 185 >SB_38504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 15 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 45 >SB_38078| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 48 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 78 >SB_37962| Best HMM Match : Tcp10_C (HMM E-Value=5.9e-36) Length = 1290 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 23 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 53 >SB_37372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_37066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 94 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 124 >SB_37030| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 49 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 79 >SB_36958| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 184 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 74 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 104 >SB_36941| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 37 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 67 >SB_36853| Best HMM Match : DNA_pol_B_exo (HMM E-Value=4.2) Length = 352 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 166 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 196 >SB_36841| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 17 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 47 >SB_36358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_36096| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_35988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 17 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 47 >SB_35856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_35732| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 67 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 97 >SB_35635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_35237| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_35223| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_35140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_35136| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_35057| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_35026| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 20 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 50 >SB_34738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_34666| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_34487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_34462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_34192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_34054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_33950| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_33934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 15 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 45 >SB_33698| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 36 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 66 >SB_33515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_33475| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 35 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 65 >SB_33369| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 37 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 67 >SB_33216| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_33186| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_32832| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 47 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 77 >SB_32571| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_32440| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_32437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_32426| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 779 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 442 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 472 >SB_32310| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_32140| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_31831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_31818| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 15 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 45 >SB_31632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_31490| Best HMM Match : Aa_trans (HMM E-Value=4.9e-31) Length = 974 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 864 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 894 >SB_31476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_31375| Best HMM Match : IQ (HMM E-Value=0.00076) Length = 327 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 217 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 247 >SB_31367| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 170 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 60 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 90 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 27 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 57 >SB_31291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_31276| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 10 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 40 >SB_31127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 15 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 45 >SB_30978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 16 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 46 >SB_30905| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 182 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 73 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 103 >SB_30644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1887 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 1035 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 1065 >SB_30600| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.7 bits (71), Expect = 0.42 Identities = 17/33 (51%), Positives = 19/33 (57%) Frame = +2 Query: 473 RVPSFLVQSGPYSESYYXLGTGPSFLQRRDWEN 571 R P + PYSESYY + LQRRDWEN Sbjct: 30 RPPPRWSSNSPYSESYY--NSLAVVLQRRDWEN 60 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,671,828 Number of Sequences: 59808 Number of extensions: 419959 Number of successful extensions: 5165 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3575 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3668 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2597949818 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -