BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_F01 (904 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. 23 2.9 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 5.0 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 6.7 EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage prot... 22 8.8 AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein pr... 22 8.8 >DQ435327-1|ABD92642.1| 145|Apis mellifera OBP10 protein. Length = 145 Score = 23.4 bits (48), Expect = 2.9 Identities = 8/26 (30%), Positives = 14/26 (53%) Frame = +1 Query: 37 IHCAXRGFFITDKLVDILCLSVIKCQ 114 +HC R F++D+++ V CQ Sbjct: 20 VHCGTRPSFVSDEMIATAASVVNACQ 45 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 22.6 bits (46), Expect = 5.0 Identities = 7/12 (58%), Positives = 10/12 (83%) Frame = +2 Query: 530 GTGPSFLQRRDW 565 GTGP+FL ++W Sbjct: 505 GTGPAFLTIKEW 516 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 6.7 Identities = 12/43 (27%), Positives = 19/43 (44%), Gaps = 1/43 (2%) Frame = -3 Query: 554 VVKTTXQCLXYNTTHYRDHFVQESWVRVSLGPSRD-TLERPRP 429 ++++ L T H DH V SW+ G + T +P P Sbjct: 452 ILESGTTTLQTRTMHPYDHLVWNSWMPSIRGAIQQWTCRQPEP 494 >EF625899-1|ABR45906.1| 1010|Apis mellifera high Glx storage protein protein. Length = 1010 Score = 21.8 bits (44), Expect = 8.8 Identities = 17/59 (28%), Positives = 24/59 (40%) Frame = -3 Query: 611 HRSKVPXQRSQXXSFPSHDVVKTTXQCLXYNTTHYRDHFVQESWVRVSLGPSRDTLERP 435 H+S+ Q Q S + + Q Y + + V + VRV LGP D RP Sbjct: 492 HQSQ-QQQEEQTQSRVRAHLKRLDHQPYQYKIAVHSEQNVPGAVVRVFLGPKHDHQGRP 549 >AF388659-4|AAK71996.1| 1308|Apis mellifera NFRKB-like protein protein. Length = 1308 Score = 21.8 bits (44), Expect = 8.8 Identities = 11/26 (42%), Positives = 17/26 (65%) Frame = -2 Query: 84 VHQLISDKESAPSTMDITQCSRIPXP 7 +HQ IS K+ +P+T ++CS I P Sbjct: 266 MHQ-ISKKKLSPATPKGSKCSMITTP 290 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,965 Number of Sequences: 438 Number of extensions: 3515 Number of successful extensions: 9 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29267238 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -