BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_E17 (1019 letters) Database: uniref50 1,657,284 sequences; 575,637,011 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenas... 43 0.015 UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein;... 42 0.019 UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; ... 42 0.019 UniRef50_Q9LVN1 Cluster: Gb|AAD23008.1; n=2; Arabidopsis thalian... 42 0.026 UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyo... 42 0.026 UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium glob... 42 0.026 UniRef50_A3LN86 Cluster: Protein involved in actin organization ... 42 0.026 UniRef50_Q86NT2 Cluster: AT04875p; n=8; Endopterygota|Rep: AT048... 42 0.034 UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, wh... 42 0.034 UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|R... 41 0.059 UniRef50_Q1XIS2 Cluster: Formactin; n=4; Caenorhabditis|Rep: For... 41 0.059 UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: ... 41 0.059 UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein... 41 0.059 UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1;... 40 0.078 UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, wh... 40 0.078 UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein... 40 0.078 UniRef50_A5C4F9 Cluster: Putative uncharacterized protein; n=1; ... 40 0.10 UniRef50_Q9TYU9 Cluster: Temporarily assigned gene name protein ... 40 0.10 UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyos... 40 0.10 UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Pro... 40 0.10 UniRef50_Q5AED9 Cluster: Branchpoint-bridging protein; n=2; Sacc... 40 0.10 UniRef50_UPI00015B5B2E Cluster: PREDICTED: similar to ENSANGP000... 40 0.14 UniRef50_Q2W1I3 Cluster: Submaxillary gland androgen regulated p... 40 0.14 UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel d... 40 0.14 UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherop... 40 0.14 UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza... 40 0.14 UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella ve... 40 0.14 UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, w... 40 0.14 UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|... 40 0.14 UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thalian... 39 0.18 UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; ... 39 0.18 UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En... 39 0.18 UniRef50_Q0DLG0 Cluster: Os05g0104000 protein; n=9; Oryza sativa... 39 0.18 UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=... 39 0.18 UniRef50_A2F7T1 Cluster: Putative uncharacterized protein; n=1; ... 39 0.18 UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, wh... 39 0.18 UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.2... 39 0.18 UniRef50_Q4PGR6 Cluster: Putative uncharacterized protein; n=1; ... 39 0.18 UniRef50_A3GHT1 Cluster: Predicted protein; n=3; Saccharomycetac... 39 0.18 UniRef50_Q8TF74 Cluster: WAS/WASL-interacting protein family mem... 39 0.18 UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome sh... 39 0.24 UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome s... 39 0.24 UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding pro... 39 0.24 UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; ... 39 0.24 UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; ... 39 0.24 UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox ca... 39 0.24 UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella ve... 39 0.24 UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2... 39 0.24 UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; ... 39 0.24 UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; ... 39 0.24 UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precu... 39 0.24 UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1;... 39 0.24 UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|... 39 0.24 UniRef50_Q54YX8 Cluster: Putative uncharacterized protein; n=1; ... 30 0.31 UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein;... 38 0.31 UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein;... 38 0.31 UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome s... 38 0.31 UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; ... 38 0.31 UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 ... 38 0.31 UniRef50_Q4PSF3 Cluster: Proline-rich extensin-like family prote... 38 0.31 UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|R... 38 0.31 UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; ... 38 0.31 UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gamb... 38 0.31 UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensi... 38 0.31 UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyosteli... 38 0.31 UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, wh... 38 0.31 UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, wh... 38 0.31 UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 38 0.31 UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n... 38 0.31 UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Hu... 38 0.31 UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 ... 38 0.42 UniRef50_UPI0000E4919E Cluster: PREDICTED: hypothetical protein;... 38 0.42 UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA... 38 0.42 UniRef50_UPI00006A19F8 Cluster: UPI00006A19F8 related cluster; n... 38 0.42 UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like prote... 38 0.42 UniRef50_Q9SNE9 Cluster: Putative uncharacterized protein F11C1_... 38 0.42 UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; ... 38 0.42 UniRef50_Q54JT5 Cluster: Component of SCAR regulatory complex; n... 38 0.42 UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, wh... 38 0.42 UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/M... 38 0.42 UniRef50_UPI0000D56E18 Cluster: PREDICTED: hypothetical protein;... 38 0.55 UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa... 38 0.55 UniRef50_Q8H9E1 Cluster: Extensin; n=6; Eukaryota|Rep: Extensin ... 38 0.55 UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b... 38 0.55 UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: ... 38 0.55 UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; ... 38 0.55 UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing pro... 38 0.55 UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, w... 38 0.55 UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus ter... 38 0.55 UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomy... 38 0.55 UniRef50_Q4RE14 Cluster: Chromosome undetermined SCAF15155, whol... 37 0.73 UniRef50_Q8W0F9 Cluster: C2 domain-containing protein-like; n=3;... 37 0.73 UniRef50_A4RW22 Cluster: Predicted protein; n=1; Ostreococcus lu... 37 0.73 UniRef50_A2YBN5 Cluster: Putative uncharacterized protein; n=3; ... 37 0.73 UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing pro... 37 0.73 UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU074... 37 0.73 UniRef50_O43516 Cluster: WAS/WASL-interacting protein family mem... 37 0.73 UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=... 37 0.73 UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi... 37 0.96 UniRef50_Q8UZB6 Cluster: Replicase; n=5; Grapevine fleck virus|R... 37 0.96 UniRef50_Q77SA5 Cluster: Viral capsid associated protein; n=1; E... 37 0.96 UniRef50_Q3V4U6 Cluster: Putative uncharacterized protein; n=1; ... 37 0.96 UniRef50_A3Q834 Cluster: Putative uncharacterized protein precur... 37 0.96 UniRef50_Q9SRL3 Cluster: F9F8.15 protein; n=13; Magnoliophyta|Re... 37 0.96 UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vu... 37 0.96 UniRef50_A2YML9 Cluster: Putative uncharacterized protein; n=2; ... 37 0.96 UniRef50_Q8MQE6 Cluster: Wasp (Actin cytoskeleton modulator) hom... 37 0.96 UniRef50_Q54ER5 Cluster: Formin homology domain-containing prote... 37 0.96 UniRef50_Q1HMI9 Cluster: Formin C; n=3; Trypanosoma cruzi|Rep: F... 37 0.96 UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: F... 37 0.96 UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cere... 37 0.96 UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein;... 36 1.3 UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein;... 36 1.3 UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein ca... 36 1.3 UniRef50_UPI0000D55F3A Cluster: PREDICTED: similar to CG14622-PC... 36 1.3 UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009;... 36 1.3 UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whol... 36 1.3 UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=... 36 1.3 UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear... 36 1.3 UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burk... 36 1.3 UniRef50_A3Q1Z8 Cluster: Molecular chaperone-like; n=4; Mycobact... 36 1.3 UniRef50_A2SK16 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_A0GWT4 Cluster: Putative uncharacterized protein; n=2; ... 36 1.3 UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza s... 36 1.3 UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; ... 36 1.3 UniRef50_Q2QUG5 Cluster: Retrotransposon protein, putative, uncl... 36 1.3 UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Re... 36 1.3 UniRef50_A5BPY4 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_Q585V1 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; ... 36 1.3 UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, wh... 36 1.3 UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, wh... 36 1.3 UniRef50_Q504V9 Cluster: ZNF341 protein; n=10; Euteleostomi|Rep:... 36 1.3 UniRef50_Q17R98 Cluster: LOC152485 protein; n=42; Euteleostomi|R... 36 1.3 UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa g... 36 1.3 UniRef50_A3GHC4 Cluster: Predicted protein; n=1; Pichia stipitis... 36 1.3 UniRef50_Q9BYN7 Cluster: Zinc finger protein 341; n=86; Eumetazo... 36 1.3 UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - ... 36 1.3 UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Sacc... 36 1.3 UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain... 36 1.7 UniRef50_Q90WR5 Cluster: Keratin alpha; n=1; Lampetra fluviatili... 36 1.7 UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome s... 36 1.7 UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; ... 36 1.7 UniRef50_Q9Q5L3 Cluster: EBNA-2; n=2; Cercopithecine herpesvirus... 36 1.7 UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|R... 36 1.7 UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter lit... 36 1.7 UniRef50_Q10BX5 Cluster: Expressed protein; n=3; Oryza sativa|Re... 36 1.7 UniRef50_Q0JA38 Cluster: Os04g0617200 protein; n=2; Oryza sativa... 36 1.7 UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukary... 36 1.7 UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole gen... 36 1.7 UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG057... 36 1.7 UniRef50_Q5CS67 Cluster: Signal peptide containing large protein... 36 1.7 UniRef50_Q5C3I4 Cluster: SJCHGC03138 protein; n=2; Schistosoma j... 36 1.7 UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|R... 36 1.7 UniRef50_A2FMX2 Cluster: DnaK protein; n=2; Trichomonas vaginali... 36 1.7 UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas ... 36 1.7 UniRef50_A2DI20 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_Q5T8W7 Cluster: Espin; n=51; Euteleostomi|Rep: Espin - ... 36 1.7 UniRef50_Q6BNL1 Cluster: Similar to sp|P32521 Saccharomyces cere... 36 1.7 UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; ... 36 1.7 UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_A5DD96 Cluster: Putative uncharacterized protein; n=1; ... 36 1.7 UniRef50_A4R0U8 Cluster: Predicted protein; n=1; Magnaporthe gri... 36 1.7 UniRef50_Q03211 Cluster: Pistil-specific extensin-like protein p... 36 1.7 UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|R... 36 1.7 UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pomb... 36 1.7 UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila mel... 36 1.7 UniRef50_O60885 Cluster: Bromodomain-containing protein 4; n=70;... 36 1.7 UniRef50_UPI000023DB29 Cluster: hypothetical protein FG02238.1; ... 36 2.2 UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome sh... 36 2.2 UniRef50_Q4RQM1 Cluster: Chromosome 2 SCAF15004, whole genome sh... 36 2.2 UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Re... 36 2.2 UniRef50_A3KGD0 Cluster: Novel protein possible orthologue to hu... 36 2.2 UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: ... 36 2.2 UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC073... 36 2.2 UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; ... 36 2.2 UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysi... 36 2.2 UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subuni... 36 2.2 UniRef50_A1G720 Cluster: Tetratricopeptide TPR_2; n=2; Salinispo... 36 2.2 UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnolioph... 36 2.2 UniRef50_Q9FLQ6 Cluster: Similarity to unknown protein; n=2; Ara... 36 2.2 UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.2... 36 2.2 UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba hist... 36 2.2 UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; ... 36 2.2 UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; ... 36 2.2 UniRef50_Q4DD93 Cluster: Putative uncharacterized protein; n=3; ... 36 2.2 UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; ... 36 2.2 UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: F... 36 2.2 UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella ve... 36 2.2 UniRef50_A5DWT6 Cluster: Putative uncharacterized protein; n=1; ... 36 2.2 UniRef50_Q05858 Cluster: Formin; n=26; Euteleostomi|Rep: Formin ... 36 2.2 UniRef50_Q6C187 Cluster: Branchpoint-bridging protein; n=1; Yarr... 36 2.2 UniRef50_UPI0000E47C9C Cluster: PREDICTED: similar to PX serine/... 35 2.9 UniRef50_Q5ZLQ1 Cluster: Putative uncharacterized protein; n=2; ... 35 2.9 UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome s... 35 2.9 UniRef50_Q9YMX1 Cluster: Essential structural protein pp78-81; n... 35 2.9 UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1;... 35 2.9 UniRef50_Q2W246 Cluster: RTX toxins and related Ca2+-binding pro... 35 2.9 UniRef50_Q1D416 Cluster: General secretory system II protein E, ... 35 2.9 UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; ... 35 2.9 UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; ... 35 2.9 UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: ... 35 2.9 UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassif... 35 2.9 UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En... 35 2.9 UniRef50_Q0JLP7 Cluster: Os01g0584100 protein; n=5; Oryza sativa... 35 2.9 UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-depe... 35 2.9 UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole gen... 35 2.9 UniRef50_Q4QBP0 Cluster: Putative uncharacterized protein; n=1; ... 35 2.9 UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella ve... 35 2.9 UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella ve... 35 2.9 UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella ve... 35 2.9 UniRef50_A4HCC8 Cluster: Putative uncharacterized protein; n=2; ... 35 2.9 UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing pro... 35 2.9 UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|... 35 2.9 UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU014... 35 2.9 UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep:... 35 2.9 UniRef50_Q5ANI0 Cluster: Potential fungal zinc cluster transcrip... 35 2.9 UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria n... 35 2.9 UniRef50_A4QQZ5 Cluster: Predicted protein; n=1; Magnaporthe gri... 35 2.9 UniRef50_Q9M1G9 Cluster: Extensin-2 precursor; n=50; Eukaryota|R... 35 2.9 UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome sh... 35 3.9 UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome... 35 3.9 UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=... 35 3.9 UniRef50_Q2J3C8 Cluster: OmpA/MotB precursor; n=4; Alphaproteoba... 35 3.9 UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep... 35 3.9 UniRef50_A3Q026 Cluster: Putative uncharacterized protein precur... 35 3.9 UniRef50_Q7XUV2 Cluster: OSJNBa0072F16.14 protein; n=3; Oryza sa... 35 3.9 UniRef50_Q2R360 Cluster: C2 domain containing protein, expressed... 35 3.9 UniRef50_Q09084 Cluster: Extensin (Class II) precursor; n=3; Sol... 35 3.9 UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliop... 35 3.9 UniRef50_Q7KUL0 Cluster: CG9425-PB, isoform B; n=4; Diptera|Rep:... 35 3.9 UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG214... 35 3.9 UniRef50_Q5DGR5 Cluster: SJCHGC08168 protein; n=1; Schistosoma j... 35 3.9 UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyosteli... 35 3.9 UniRef50_Q16PS7 Cluster: Cxyorf1; n=3; Culicidae|Rep: Cxyorf1 - ... 35 3.9 UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; ... 35 3.9 UniRef50_Q2GRR5 Cluster: Putative uncharacterized protein; n=1; ... 35 3.9 UniRef50_Q2GNY9 Cluster: Putative uncharacterized protein; n=2; ... 35 3.9 UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; ... 35 3.9 UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; ... 35 3.9 UniRef50_A2R7D2 Cluster: Contig An16c0100, complete genome; n=1;... 35 3.9 UniRef50_Q09493 Cluster: Putative uncharacterized protein shn-1;... 31 4.2 UniRef50_Q7YYP6 Cluster: Hydroxyproline-rich glycoprotein dz-hrg... 31 4.3 UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2... 34 5.1 UniRef50_UPI00015B4302 Cluster: PREDICTED: similar to Wiskott-Al... 34 5.1 UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; ... 34 5.1 UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain... 34 5.1 UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein;... 34 5.1 UniRef50_UPI0000DB6FB3 Cluster: PREDICTED: similar to plexus CG4... 34 5.1 UniRef50_UPI0000498915 Cluster: hypothetical protein 9.t00033; n... 34 5.1 UniRef50_UPI0000DC1448 Cluster: UPI0000DC1448 related cluster; n... 34 5.1 UniRef50_UPI0000DC03C7 Cluster: formin-like 2; n=1; Rattus norve... 34 5.1 UniRef50_UPI0000ECCC14 Cluster: WAS/WASL interacting protein fam... 34 5.1 UniRef50_Q2NNS2 Cluster: 1629capsid; n=1; Hyphantria cunea nucle... 34 5.1 UniRef50_O35328 Cluster: Proline-rich protein 9-1; n=2; Mus musc... 34 5.1 UniRef50_Q1NAT8 Cluster: Putative uncharacterized protein; n=1; ... 34 5.1 UniRef50_Q1IA36 Cluster: Insecticidal toxin, SepC/Tcc class; n=1... 34 5.1 UniRef50_Q0ANI5 Cluster: OmpA/MotB domain protein precursor; n=2... 34 5.1 UniRef50_A6G312 Cluster: Serine/threonine protein kinase; n=1; P... 34 5.1 UniRef50_A6APN4 Cluster: Insecticidal toxin, SepC/Tcc class; n=2... 34 5.1 UniRef50_A3TPE4 Cluster: Putative uncharacterized protein; n=1; ... 34 5.1 UniRef50_Q9XIP3 Cluster: Putative uncharacterized protein At2g27... 34 5.1 UniRef50_Q9XIE0 Cluster: F23H11.22 protein; n=1; Arabidopsis tha... 34 5.1 UniRef50_Q41645 Cluster: Extensin; n=1; Volvox carteri|Rep: Exte... 34 5.1 UniRef50_Q3ECQ3 Cluster: Uncharacterized protein At1g54215.1; n=... 34 5.1 UniRef50_A4RU08 Cluster: Predicted protein; n=1; Ostreococcus lu... 34 5.1 UniRef50_A2XPC7 Cluster: Putative uncharacterized protein; n=3; ... 34 5.1 UniRef50_Q9VSQ1 Cluster: CG32030-PA, isoform A; n=9; Endopterygo... 34 5.1 UniRef50_Q93107 Cluster: Myosin I heavy chain kinase; n=1; Acant... 34 5.1 UniRef50_Q61UQ5 Cluster: Putative uncharacterized protein CBG051... 34 5.1 UniRef50_A2FYK8 Cluster: Putative uncharacterized protein; n=1; ... 34 5.1 UniRef50_A0E1N2 Cluster: Chromosome undetermined scaffold_73, wh... 34 5.1 UniRef50_Q6CFA6 Cluster: Similarity; n=1; Yarrowia lipolytica|Re... 34 5.1 UniRef50_A7ER22 Cluster: Predicted protein; n=1; Sclerotinia scl... 34 5.1 UniRef50_A4RC14 Cluster: Predicted protein; n=1; Magnaporthe gri... 34 5.1 UniRef50_A3LVW7 Cluster: Predicted protein; n=1; Pichia stipitis... 34 5.1 UniRef50_A1CD74 Cluster: DUF1720 domain protein; n=17; Pezizomyc... 34 5.1 UniRef50_UPI00015BDD6A Cluster: UPI00015BDD6A related cluster; n... 34 6.8 UniRef50_UPI00015B5935 Cluster: PREDICTED: similar to prIL-16; n... 34 6.8 UniRef50_UPI0000F2E28C Cluster: PREDICTED: similar to high-mobil... 34 6.8 UniRef50_UPI0000E4A382 Cluster: PREDICTED: similar to DNA-depend... 34 6.8 UniRef50_UPI0000499A11 Cluster: hypothetical protein 42.t00003; ... 34 6.8 UniRef50_UPI000049834E Cluster: FH2 domain protein; n=1; Entamoe... 34 6.8 UniRef50_UPI0000F31107 Cluster: PREDICTED: Bos taurus similar to... 34 6.8 UniRef50_Q91BL3 Cluster: Essential structural protein pp78/81; n... 34 6.8 UniRef50_Q2W2R6 Cluster: Trypsin-like serine protease,; n=2; Mag... 34 6.8 UniRef50_Q2W2A9 Cluster: Periplasmic protein TonB, links inner a... 34 6.8 UniRef50_Q0S5Y2 Cluster: Putative uncharacterized protein; n=1; ... 34 6.8 UniRef50_A6GF06 Cluster: Putative uncharacterized protein; n=1; ... 34 6.8 UniRef50_Q9ATK5 Cluster: PF6 protein; n=1; Chlamydomonas reinhar... 34 6.8 UniRef50_Q6ZD62 Cluster: Putative pherophorin-dz1 protein; n=4; ... 34 6.8 UniRef50_Q41805 Cluster: Extensin-like protein precursor; n=15; ... 34 6.8 UniRef50_Q41192 Cluster: NaPRP3; n=1; Nicotiana alata|Rep: NaPRP... 34 6.8 UniRef50_Q1EP07 Cluster: Putative uncharacterized protein; n=1; ... 34 6.8 UniRef50_Q0DB93 Cluster: Os06g0590100 protein; n=11; Oryza sativ... 34 6.8 UniRef50_O49986 Cluster: 120 kDa style glycoprotein; n=12; Nicot... 34 6.8 UniRef50_Q7KW17 Cluster: CG14622-PC, isoform C; n=10; Coelomata|... 34 6.8 UniRef50_Q5C200 Cluster: SJCHGC08716 protein; n=1; Schistosoma j... 34 6.8 UniRef50_Q20327 Cluster: Ground-like (Grd related) protein 4; n=... 34 6.8 UniRef50_A3QX14 Cluster: Wiskott-Aldrich syndrome protein; n=1; ... 34 6.8 UniRef50_Q4WNW8 Cluster: KH domain protein; n=13; Pezizomycotina... 34 6.8 UniRef50_Q1E467 Cluster: Putative uncharacterized protein; n=1; ... 34 6.8 UniRef50_Q0CLE5 Cluster: Predicted protein; n=1; Aspergillus ter... 34 6.8 UniRef50_A5DP36 Cluster: Putative uncharacterized protein; n=1; ... 34 6.8 UniRef50_O60879 Cluster: Protein diaphanous homolog 2; n=26; Eut... 34 6.8 UniRef50_P34308 Cluster: Calpain clp-1; n=5; Caenorhabditis eleg... 34 6.8 UniRef50_A1Z8G3 Cluster: CG13227-PA; n=1; Drosophila melanogaste... 29 8.8 UniRef50_P41832 Cluster: Protein BNI1; n=2; Saccharomyces cerevi... 31 8.8 UniRef50_UPI0000E491BF Cluster: PREDICTED: similar to FHOS2L spl... 33 8.9 UniRef50_UPI0000E48C31 Cluster: PREDICTED: hypothetical protein;... 33 8.9 UniRef50_UPI0000E482F8 Cluster: PREDICTED: similar to dishevelle... 33 8.9 UniRef50_UPI0000D56EFA Cluster: PREDICTED: similar to Protein ca... 33 8.9 UniRef50_UPI0000D55BF8 Cluster: PREDICTED: similar to CG32030-PA... 33 8.9 UniRef50_UPI000049A0E6 Cluster: diaphanous protein; n=1; Entamoe... 33 8.9 UniRef50_UPI000023E328 Cluster: hypothetical protein FG01070.1; ... 33 8.9 UniRef50_UPI0000F30AB8 Cluster: UPI0000F30AB8 related cluster; n... 33 8.9 UniRef50_Q4S6X9 Cluster: Chromosome 14 SCAF14723, whole genome s... 33 8.9 UniRef50_Q0N496 Cluster: ORF1629; n=1; Clanis bilineata nucleopo... 33 8.9 UniRef50_Q5XHX3 Cluster: Enabled homolog; n=5; Tetrapoda|Rep: En... 33 8.9 UniRef50_Q5FRE9 Cluster: Putative uncharacterized protein; n=1; ... 33 8.9 UniRef50_Q56B20 Cluster: Cell surface antigen Sca2-6; n=4; Ricke... 33 8.9 UniRef50_A5FYS1 Cluster: Putative uncharacterized protein precur... 33 8.9 UniRef50_Q9FXA1 Cluster: F14J22.4 protein; n=2; Arabidopsis thal... 33 8.9 UniRef50_Q8LJ87 Cluster: Putative leucine-rich repeat/extensin 1... 33 8.9 UniRef50_Q8L7S5 Cluster: AT4g18560/F28J12_220; n=2; Arabidopsis ... 33 8.9 UniRef50_Q69X10 Cluster: Putative uncharacterized protein P0481H... 33 8.9 UniRef50_Q0J6R0 Cluster: Os08g0280200 protein; n=2; Oryza sativa... 33 8.9 UniRef50_Q01HW3 Cluster: B0616E02-H0507E05.9 protein; n=4; Oryza... 33 8.9 UniRef50_Q01DC8 Cluster: Plg protein; n=2; Eukaryota|Rep: Plg pr... 33 8.9 UniRef50_Q00TD0 Cluster: Chromosome 17 contig 1, DNA sequence; n... 33 8.9 UniRef50_A7DWG3 Cluster: Cell wall glycoprotein GP2; n=4; Chlamy... 33 8.9 UniRef50_A4S9A6 Cluster: Predicted protein; n=1; Ostreococcus lu... 33 8.9 UniRef50_A4S6G3 Cluster: Predicted protein; n=2; Eukaryota|Rep: ... 33 8.9 UniRef50_Q94273 Cluster: Ground-like (Grd related) protein 6; n=... 33 8.9 UniRef50_Q86BM9 Cluster: CG33003-PA; n=1; Drosophila melanogaste... 33 8.9 UniRef50_Q6IIW5 Cluster: HDC16773; n=3; Endopterygota|Rep: HDC16... 33 8.9 UniRef50_Q5WNL4 Cluster: Putative uncharacterized protein CBG079... 33 8.9 UniRef50_Q4QIK8 Cluster: Putative uncharacterized protein; n=2; ... 33 8.9 UniRef50_A7RNZ0 Cluster: Predicted protein; n=1; Nematostella ve... 33 8.9 UniRef50_A2EKU5 Cluster: Putative uncharacterized protein; n=1; ... 33 8.9 UniRef50_Q0U6P3 Cluster: Predicted protein; n=1; Phaeosphaeria n... 33 8.9 UniRef50_A7F7G2 Cluster: Putative uncharacterized protein; n=2; ... 33 8.9 UniRef50_A7EUH8 Cluster: Putative uncharacterized protein; n=1; ... 33 8.9 UniRef50_A3LZQ9 Cluster: Predicted protein; n=1; Pichia stipitis... 33 8.9 UniRef50_P42768 Cluster: Wiskott-Aldrich syndrome protein; n=14;... 33 8.9 UniRef50_Q12446 Cluster: Proline-rich protein LAS17; n=4; Saccha... 33 8.9 UniRef50_P42858 Cluster: Huntingtin; n=29; Eumetazoa|Rep: Huntin... 33 8.9 UniRef50_A5X799 Cluster: Jxc1; n=1; Anopheles gambiae|Rep: Jxc1 ... 25 9.6 >UniRef50_Q64467 Cluster: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific; n=287; cellular organisms|Rep: Glyceraldehyde-3-phosphate dehydrogenase, testis-specific - Mus musculus (Mouse) Length = 440 Score = 42.7 bits (96), Expect = 0.015 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K + PPPPP PPPP Sbjct: 66 PPPPPPPPQIEPDKFEEAPPPPPPPPPPPPPP 97 Score = 39.9 bits (89), Expect = 0.10 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 67 PPPPPPPQIEPDKFEEAPPPPPPPPPPPPPPP 98 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 65 PPPPPPPPPQIEPDKFEEAPPPPPPPPPPPPP 96 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 68 PPPPPPQIEPDKFEEAPPPPPPPPPPPPPPPP 99 Score = 37.5 bits (83), Expect = 0.55 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP ++ PPPPP PPPP Sbjct: 69 PPPPPQIEPDKFEEAPPPPPPPPPPPPPPPPP 100 Score = 35.9 bits (79), Expect = 1.7 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP + + PPPPP PPPP Sbjct: 38 PPPPKLEDPPPTVEEQPPPPPPPPPPPPPP 67 >UniRef50_UPI0000F1DAD0 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1102 Score = 42.3 bits (95), Expect = 0.019 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP GPPPP Sbjct: 589 GAEAPPPPPPPPPPSGSGGAPPPPPPPPPPGGGPPPP 625 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPPPP + PPPPP G PPPP Sbjct: 579 PPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPPP 612 Score = 37.1 bits (82), Expect = 0.73 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP GPPPP Sbjct: 606 GGAPPPPPPPPPPGGGPP------PPPPPPGSGPPPP 636 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP--XXXGPPPP 512 PPPPPP + PPPPP G PPP Sbjct: 578 PPPPPPPPPLPGAEAPPPPPPPPPPSGSGGAPPP 611 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 604 GSGGAPPPPPPPPPPGG---GPPPPPPPPGSGPPPPP 637 >UniRef50_Q9BL72 Cluster: Putative uncharacterized protein; n=2; Caenorhabditis|Rep: Putative uncharacterized protein - Caenorhabditis elegans Length = 1115 Score = 42.3 bits (95), Expect = 0.019 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP GPPPP Sbjct: 561 PPPPPPPLPQNLSGAPPPPPPPPPMLGGPPPP 592 >UniRef50_Q9LVN1 Cluster: Gb|AAD23008.1; n=2; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1307 Score = 41.9 bits (94), Expect = 0.026 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPPP + K PPPPP PP P Sbjct: 688 RPPPPPPPPPMQHSTVTKVPPPPPPAPPAPPTP 720 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 K PPPPPP I PPPP PPP Sbjct: 705 KVPPPPPPAPPAPPTPIVHTSSPPPPPPPPPPP 737 >UniRef50_Q54WZ5 Cluster: Slob family protein kinase; n=1; Dictyostelium discoideum AX4|Rep: Slob family protein kinase - Dictyostelium discoideum AX4 Length = 574 Score = 41.9 bits (94), Expect = 0.026 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP GPPPP Sbjct: 497 PPPPPPPPPPSKSSGPPPPPPPPPKSSGPPPP 528 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 512 PPPPPPPPPKS-----SGPPPPPPPKSSPPPP 538 >UniRef50_Q2H4B7 Cluster: Predicted protein; n=1; Chaetomium globosum|Rep: Predicted protein - Chaetomium globosum (Soil fungus) Length = 205 Score = 41.9 bits (94), Expect = 0.026 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K + PPPPP PPPP Sbjct: 134 PPPPPPPPPASSTKSAEAPPPPPPPPPPPPPP 165 Score = 41.9 bits (94), Expect = 0.026 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 135 PPPPPPPPASSTKSAEAPPPPPPPPPPPPPPP 166 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 133 PPPPPPPPPPASSTKSAEAPPPPPPPPPPPPP 164 >UniRef50_A3LN86 Cluster: Protein involved in actin organization and endocytosis; n=2; Saccharomycetales|Rep: Protein involved in actin organization and endocytosis - Pichia stipitis (Yeast) Length = 1373 Score = 41.9 bits (94), Expect = 0.026 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP GPPPP Sbjct: 1294 PPPPPPPGPPPIPNAPFGAPPPPPPPPGPPPP 1325 >UniRef50_Q86NT2 Cluster: AT04875p; n=8; Endopterygota|Rep: AT04875p - Drosophila melanogaster (Fruit fly) Length = 1273 Score = 41.5 bits (93), Expect = 0.034 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPPPP PPPP F Sbjct: 696 PPPPPPMPASPTASSAAPPPPPPPAPPAPPPPPGF 730 >UniRef50_A0D550 Cluster: Chromosome undetermined scaffold_38, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_38, whole genome shotgun sequence - Paramecium tetraurelia Length = 493 Score = 41.5 bits (93), Expect = 0.034 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP GPPPP Sbjct: 366 PPPPPPPPPPKGAPPPPPPPPPPPPPPGPPPP 397 >UniRef50_Q8GD27 Cluster: Adhesin FhaB; n=3; cellular organisms|Rep: Adhesin FhaB - Bordetella avium Length = 2621 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/34 (50%), Positives = 18/34 (52%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP--XXXGPPPP 512 PPPPPP KK+ PPPPP PPPP Sbjct: 2326 PPPPPPPPPPKVKKVDPPPPPPPPKVKKVDPPPP 2359 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP----XXXGPPPP 512 PPPPPP KK+ PPPPP PPPP Sbjct: 2356 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP 2391 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP----XXXGPPPP 512 PPPPPP KK+ PPPPP PPPP Sbjct: 2389 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP 2424 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP----XXXGPPPP 512 PPPPPP KK+ PPPPP PPPP Sbjct: 2405 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP 2440 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP----XXXGPPPP 512 PPPPPP KK+ PPPPP PPPP Sbjct: 2438 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP 2473 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/36 (47%), Positives = 18/36 (50%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP----XXXGPPPP 512 PPPPPP KK+ PPPPP PPPP Sbjct: 2454 PPPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP 2489 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP-----XXXGPPPP 512 PPPPPP KK+ PPPPP PPPP Sbjct: 2372 PPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPP 2408 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KK PPPP K+ K PPPPP PPPP Sbjct: 2384 KKVDPPPPPPPPPPPKVKKVDPPPPPP---PPPP 2414 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/37 (45%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP-----XXXGPPPP 512 PPPPPP KK+ PPPPP PPPP Sbjct: 2421 PPPPPPPPPPKVKKVDPPPPPPPPPPPKVKKVDPPPP 2457 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KK PPPP K+ K PPPPP PPPP Sbjct: 2433 KKVDPPPPPPPPPPPKVKKVDPPPPPP---PPPP 2463 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/34 (47%), Positives = 17/34 (50%), Gaps = 3/34 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP---XXXGPPP 509 PPPPPP KK+ PPPPP PPP Sbjct: 2470 PPPPPPPPPPKVKKVDPPPPPPPPPKVKKVDPPP 2503 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 4/38 (10%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPP----XXXGPPPP 512 KK PPPP KK+ PPPPP PPPP Sbjct: 2338 KKVDPPPPPPPPKVKKVDPPPPPPPPPPKVKKVDPPPP 2375 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K+ K PPPPP PPPP Sbjct: 2471 PPPPPP----PPPKVKKVDPPPPP----PPPP 2494 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP K+ K PPPPP PPPP Sbjct: 2369 KVDPPPPP--PPPPPKVKKVDPPPPPPP--PPPP 2398 Score = 35.1 bits (77), Expect = 2.9 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP K+ K PPPPP PPPP Sbjct: 2418 KVDPPPPP--PPPPPKVKKVDPPPPPPP--PPPP 2447 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP K+ K PPPPP PPPP Sbjct: 2353 KVDPPPPP--PPPPPKVKKVDPPPPPP---PPPP 2381 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP K+ K PPPPP PPPP Sbjct: 2402 KVDPPPPP--PPPPPKVKKVDPPPPPP---PPPP 2430 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP K+ K PPPPP PPPP Sbjct: 2451 KVDPPPPP--PPPPPKVKKVDPPPPPP---PPPP 2479 >UniRef50_Q1XIS2 Cluster: Formactin; n=4; Caenorhabditis|Rep: Formactin - Caenorhabditis elegans Length = 1346 Score = 40.7 bits (91), Expect = 0.059 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP ++ PPPPP PPPP Sbjct: 766 GVGVPPPPPPPSAIPLPPRLQGGIPPPPPLGIIPPPP 802 >UniRef50_A5JUU8 Cluster: Formin B; n=2; Trypanosoma brucei|Rep: Formin B - Trypanosoma brucei TREU927 Length = 1004 Score = 40.7 bits (91), Expect = 0.059 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP K PPPPP G PPP Sbjct: 507 GGKLPPPPPPPGKAPPPPPGGKLPPPPPPGGKGAPPP 543 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP K PPPPP PPPP Sbjct: 495 GGKLPPPPPPPPG-------GKLPPPPPPPGKAPPPP 524 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPPP K+ PPPP PPPP Sbjct: 486 KLPPPPPPPGG----KLPPPPPPPPGGKLPPPPP 515 >UniRef50_O00401 Cluster: Neural Wiskott-Aldrich syndrome protein; n=39; Eukaryota|Rep: Neural Wiskott-Aldrich syndrome protein - Homo sapiens (Human) Length = 505 Score = 40.7 bits (91), Expect = 0.059 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP GPPPP Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPP 388 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP GPPPP Sbjct: 277 PPPPPP------SRGGPPPPPPPPHNSGPPPP 302 >UniRef50_Q8L685 Cluster: Pherophorin-dz1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-dz1 protein precursor - Volvox carteri f. nagariensis Length = 1009 Score = 40.3 bits (90), Expect = 0.078 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 661 PPPPPPPPPPPPPPLPPSPPPPPPPPPPPPPP 692 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 651 PPPPPPPPPPPPPPPPPPPPPPPPLPPSPPPP 682 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 664 PPPPPPPPPPPLPPSPPPPPPPPPPPPPPPPP 695 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 665 PPPPPPPPPPLPPSPPPPPPPPPPPPPPPPPP 696 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 666 PPPPPPPPPLPPSPPPPPPPPPPPPPPPPPPP 697 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 229 PPPPPPSPPPPLPPPPPPPPPPPPPPPPPPPP 260 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 241 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 272 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 242 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 273 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 243 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 274 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 276 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 277 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 278 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 279 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 249 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 280 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 250 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 281 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 251 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 282 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 252 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 283 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 284 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 285 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 286 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 287 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 257 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 288 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 289 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 259 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 290 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 291 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 261 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 292 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 262 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 293 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 263 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 294 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 264 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 295 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 265 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 296 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 266 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 297 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 267 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 298 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 268 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 269 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 270 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 301 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 271 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 302 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 272 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 303 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 273 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 304 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 274 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 305 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 275 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 306 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 276 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 307 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 277 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 308 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 278 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 309 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 279 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 310 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 280 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 311 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 281 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 312 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 282 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 313 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 283 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 314 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 284 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 315 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 285 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 316 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 286 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 317 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 287 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 318 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 288 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 319 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 289 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 320 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 290 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 321 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 291 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 322 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 292 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 323 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 293 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 324 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 294 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 325 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 295 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 326 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 296 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 327 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 297 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 328 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 298 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 329 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 299 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 330 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 300 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 331 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 301 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 332 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 302 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 333 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 303 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 334 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 304 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 335 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 305 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 336 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 337 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 307 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 338 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 308 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 339 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 309 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 340 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 310 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 341 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 311 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 342 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 312 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 343 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 313 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 344 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 314 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 345 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 315 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 346 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 316 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 347 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 317 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 348 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 318 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 349 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 319 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 350 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 320 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 351 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 321 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 352 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 322 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 353 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 323 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 354 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 324 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 355 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 325 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 356 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 326 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 357 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 327 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 358 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 328 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 359 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 329 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 360 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 330 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 361 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 331 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 362 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 332 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 363 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 333 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 364 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 334 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 365 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 335 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 366 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 336 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 367 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 337 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 368 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 338 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 369 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 339 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 370 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 340 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 371 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 341 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 372 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 342 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 373 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 343 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 374 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 344 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 375 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 345 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 376 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 346 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 377 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 347 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 378 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 348 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 379 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 349 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 380 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 350 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 381 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 351 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 382 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 352 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 383 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 353 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 384 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 354 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 385 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 355 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 386 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 356 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 387 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 357 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 388 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 358 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 389 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 359 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 390 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 360 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 391 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 361 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 392 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 362 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 393 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 363 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 394 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 364 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 395 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 365 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 396 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 366 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 397 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 367 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 398 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 368 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 399 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 369 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 400 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 370 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 401 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 371 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 402 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 372 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 403 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 373 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 404 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 374 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 405 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 375 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 406 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 376 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 407 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 377 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 408 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 378 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 409 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 379 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 410 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 380 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 411 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 381 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 412 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 382 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 413 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 414 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 415 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 416 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 386 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 417 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 387 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 418 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 388 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 419 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 389 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 420 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 390 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 421 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 391 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 422 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 392 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 423 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 393 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 424 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 394 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 425 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 395 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 426 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 396 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 427 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 397 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 428 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 398 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 429 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 399 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 430 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 400 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 431 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 401 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 432 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 402 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 433 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 403 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 434 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 404 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 435 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 405 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 436 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 406 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 437 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 407 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 438 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 408 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 439 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 409 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 440 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 410 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 441 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 411 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 442 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 443 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 413 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 444 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 414 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 445 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 415 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 446 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 416 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 447 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 417 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 448 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 418 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 449 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 419 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 450 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 420 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 451 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 421 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 452 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 422 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 453 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 423 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 454 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 424 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 455 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 425 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 456 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 426 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 457 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 427 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 458 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 428 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 459 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 429 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 460 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 430 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 461 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 431 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 462 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 432 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 463 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 433 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 464 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 434 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 465 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 435 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 466 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 436 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 467 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 437 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 468 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 438 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 469 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 439 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 470 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 440 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 471 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 441 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 472 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 442 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 473 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 443 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 474 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 444 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 475 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 445 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 476 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 446 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 477 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 447 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 478 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 448 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 479 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 449 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 480 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 450 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 481 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 451 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 482 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 452 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 483 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 453 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 484 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 454 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 485 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 455 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 486 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 456 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 487 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 457 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 488 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 458 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 489 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 459 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 490 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 460 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 491 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 461 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 492 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 462 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 493 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 463 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 494 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 464 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 495 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 465 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 496 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 466 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 497 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 467 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 499 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 469 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 500 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 470 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 501 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 471 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 502 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 472 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 503 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 473 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 504 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 474 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 505 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 475 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 506 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 476 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 507 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 477 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 508 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 478 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 509 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 479 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 510 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 480 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 511 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 481 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 512 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 482 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 513 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 483 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 514 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 484 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 515 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 485 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 516 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 486 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 517 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 487 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 518 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 488 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 519 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 489 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 520 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 490 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 521 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 491 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 522 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 492 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 523 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 493 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 524 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 494 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 525 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 495 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 526 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 496 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 527 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 497 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 528 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 498 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 529 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 499 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 530 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 500 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 531 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 501 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 532 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 502 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 533 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 503 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 534 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 504 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 535 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 505 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 536 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 506 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 537 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 507 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 538 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 508 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 539 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 509 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 540 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 510 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 541 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 511 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 542 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 512 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 543 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 513 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 544 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 514 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 545 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 515 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 546 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 516 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 547 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 517 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 548 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 518 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 549 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 519 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 550 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 520 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 551 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 521 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 552 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 522 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 553 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 523 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 554 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 524 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 555 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 525 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 556 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 526 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 557 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 527 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 558 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 528 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 559 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 529 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 560 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 530 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 561 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 531 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 562 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 532 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 563 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 533 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 564 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 534 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 565 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 535 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 566 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 536 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 567 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 537 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 568 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 538 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 569 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 539 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 570 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 540 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 571 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 541 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 572 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 542 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 573 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 543 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 574 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 544 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 575 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 545 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 576 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 546 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 577 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 547 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 578 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 548 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 579 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 549 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 580 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 550 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 581 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 551 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 582 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 552 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 583 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 553 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 584 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 554 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 585 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 555 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 586 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 556 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 587 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 557 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 588 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 558 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 589 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 559 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 590 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 560 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 591 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 561 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 592 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 562 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 593 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 563 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 594 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 564 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 595 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 565 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 596 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 566 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 597 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 567 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 598 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 568 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 599 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 569 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 600 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 570 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 601 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 571 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 602 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 572 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 603 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 573 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 604 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 574 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 605 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 575 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 606 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 576 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 607 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 577 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 608 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 578 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 609 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 579 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 610 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 580 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 611 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 581 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 612 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 582 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 613 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 583 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 614 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 584 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 615 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 585 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 616 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 586 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 617 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 587 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 618 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 588 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 619 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 589 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 620 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 590 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 621 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 591 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 622 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 592 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 623 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 593 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 624 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 594 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 625 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 595 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 626 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 596 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 627 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 597 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 628 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 598 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 629 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 599 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 630 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 600 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 631 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 601 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 632 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 602 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 633 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 603 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 634 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 604 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 635 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 605 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 636 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 606 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 637 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 607 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 638 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 608 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 639 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 609 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 640 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 610 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 641 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 611 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 642 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 612 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 643 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 613 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 644 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 614 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 645 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 615 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 646 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 616 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 647 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 617 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 648 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 618 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 649 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 619 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 650 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 620 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 651 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 621 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 652 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 622 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 653 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 623 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 654 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 624 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 655 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 625 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 656 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 626 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 657 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 627 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 658 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 628 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 659 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 629 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 660 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 630 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 661 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 631 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 662 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 632 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 663 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 633 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 664 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 634 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 665 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 635 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 666 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 636 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 667 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 637 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 668 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 638 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 669 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 639 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 670 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 640 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 671 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 641 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 672 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 642 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 673 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 643 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 674 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 660 PPPPPPPPPPPPPPPLPPSPPPPPPPPPPPPP 691 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 662 PPPPPPPPPPPPPLPPSPPPPPPPPPPPPPPP 693 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 667 PPPPPPPPLPPSPPPPPPPPPPPPPPPPPPPP 698 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 668 PPPPPPPLPPSPPPPPPPPPPPPPPPPPPPPP 699 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 669 PPPPPPLPPSPPPPPPPPPPPPPPPPPPPPPP 700 Score = 37.1 bits (82), Expect = 0.73 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP + PPPPP PPPP Sbjct: 226 PPSPPPPPPSPPPPLPPPPPPPPPPPPPPPPP 257 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 214 PPPPPPLPPSPPPPSPPPPPPSPPPPLPPPPP 245 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 222 PSPPPPSPPPPPPSPPPPLPPPPPPPPPPPPP 253 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 225 PPPSPPPPPPSPPPPLPPPPPPPPPPPPPPPP 256 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 231 PPPPSPPPPLPPPPPPPPPPPPPPPPPPPPPP 262 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 232 PPPSPPPPLPPPPPPPPPPPPPPPPPPPPPPP 263 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 233 PPSPPPPLPPPPPPPPPPPPPPPPPPPPPPPP 264 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 234 PSPPPPLPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 649 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPSPP 680 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 650 PPPPPPPPPPPPPPPPPPPPPPPPPLPPSPPP 681 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 657 PPPPPPPPPPPPPPPPPPLPPSPPPPPPPPPP 688 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 676 PPSPPPPPPPPPPPPPPPPPPPPPPPPHPPPP 707 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 679 PPPPPPPPPPPPPPPPPPPPPPPPHPPPPSPP 710 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 236 PPPPLPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 237 PPPLPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 648 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPSP 679 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 671 PPPPLPPSPPPPPPPPPPPPPPPPPPPPPPPP 702 >UniRef50_A0DA74 Cluster: Chromosome undetermined scaffold_43, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_43, whole genome shotgun sequence - Paramecium tetraurelia Length = 1401 Score = 40.3 bits (90), Expect = 0.078 Identities = 18/39 (46%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPX--XXGPPPP 512 G PPPPPP K PPPPP GPPPP Sbjct: 835 GGKSAPPPPPPPPPPGGKGAPPPPPPPPPPGSKTGPPPP 873 Score = 39.1 bits (87), Expect = 0.18 Identities = 16/32 (50%), Positives = 18/32 (56%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K + + PPPPP PPPP Sbjct: 807 PPPPPPPPPGGSKTLPRPPPPPPP----PPPP 834 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 826 PPPPPPPPPGGKSAPPPPPPPPPPGGKGAPPP 857 Score = 37.9 bits (84), Expect = 0.42 Identities = 18/40 (45%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPX---XXGPPPP 512 G PPPPPP K PPPPP GPPPP Sbjct: 865 GSKTGPPPPPPPPPPGAKTGSAPPPPPPPGGPRPPGPPPP 904 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 827 PPPPPPPPGGKSAPPPPPPPPPPGGKGAPPPP 858 Score = 34.7 bits (76), Expect = 3.9 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPP----XXXGPPPP 512 G PPPPPP K PPPPP PPPP Sbjct: 850 GGKGAPPPPPPPPPPGSKTGPPPPPPPPPPGAKTGSAPPPP 890 >UniRef50_Q5KAA5 Cluster: Cytokinesis protein sepa (Fh1/2 protein), putative; n=1; Filobasidiella neoformans|Rep: Cytokinesis protein sepa (Fh1/2 protein), putative - Cryptococcus neoformans (Filobasidiella neoformans) Length = 1776 Score = 40.3 bits (90), Expect = 0.078 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP I PPPPP PPPP Sbjct: 1096 PPPPPPPPPPPPGAIGLTAPPPPPPPPPPPPP 1127 >UniRef50_A5C4F9 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 1064 Score = 39.9 bits (89), Expect = 0.10 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 745 PPPPPPPPPLXKNLSTRAVPPPPPPPPPPPPP 776 >UniRef50_Q9TYU9 Cluster: Temporarily assigned gene name protein 268; n=2; Caenorhabditis|Rep: Temporarily assigned gene name protein 268 - Caenorhabditis elegans Length = 881 Score = 39.9 bits (89), Expect = 0.10 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 70 PPPPPPLISILQQAPPPPPPPPPPTLKAPPPP 101 Score = 37.5 bits (83), Expect = 0.55 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP ++ PPPPP PPP Sbjct: 69 PPPPPPPLISILQQAPPPPPPPPPPTLKAPPP 100 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP + + PPPPP PPPP Sbjct: 64 KATPPPPPPPPPLISILQQAPPPPPP----PPPP 93 >UniRef50_Q8IU42 Cluster: Formin homology protein A; n=2; Dictyostelium discoideum|Rep: Formin homology protein A - Dictyostelium discoideum (Slime mold) Length = 1218 Score = 39.9 bits (89), Expect = 0.10 Identities = 18/36 (50%), Positives = 18/36 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP K PPPPP GPPPP F Sbjct: 717 PPPPPPPPGA---KAGGPPPPPPPFGKGPPPPPGGF 749 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPP GPPPP Sbjct: 659 GGGAPPPPPPPPPMTGGGGPPPPPPPPPMTGGGPPPP 695 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP GPPPP Sbjct: 689 GGGPPPPPPPPPMTGGGPP-----PPPPPPGGGPPPP 720 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPP GPPPP Sbjct: 675 GGGPPPPPPPPPMTGGGP--PPPPPPPPMTGGGPPPP 709 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP GPPPP Sbjct: 650 PPPPPPPMTGGGAPPPPPPPPPMTGGGGPPPP 681 >UniRef50_Q5CLH8 Cluster: Protease; n=3; Cryptosporidium|Rep: Protease - Cryptosporidium hominis Length = 1569 Score = 39.9 bits (89), Expect = 0.10 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 1535 PPPPPPPPPPPSSSSPSPPPPPPPLPPPPPPP 1566 Score = 39.5 bits (88), Expect = 0.14 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 1534 PPPPPPPPPPPPSSSSPSPPPPPPPLPPPPPP 1565 >UniRef50_Q5AED9 Cluster: Branchpoint-bridging protein; n=2; Saccharomycetales|Rep: Branchpoint-bridging protein - Candida albicans (Yeast) Length = 455 Score = 39.9 bits (89), Expect = 0.10 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP +I K PPPPP PPPP Sbjct: 340 PPPPPPAPPSSSTEISKQVPPPPPP---PPPP 368 >UniRef50_UPI00015B5B2E Cluster: PREDICTED: similar to ENSANGP00000010144; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to ENSANGP00000010144 - Nasonia vitripennis Length = 483 Score = 39.5 bits (88), Expect = 0.14 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 183 PPPPPPAAAAPPPPSHAPPPPPPPPASAPPPP 214 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP PPPPP PPP Sbjct: 180 KAAPPPPPPAAAAPPPPSHAPPPPPPPPASAPPP 213 >UniRef50_Q2W1I3 Cluster: Submaxillary gland androgen regulated protein 1; n=1; Magnetospirillum magneticum AMB-1|Rep: Submaxillary gland androgen regulated protein 1 - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 85 Score = 39.5 bits (88), Expect = 0.14 Identities = 19/42 (45%), Positives = 20/42 (47%), Gaps = 2/42 (4%) Frame = +3 Query: 402 GXXKKPPP-PPPXXXXXXKKIXKXXPP-PPPXXXGPPPPXXF 521 G KPPP PPP + PP PPP GPPPP F Sbjct: 31 GPPPKPPPLPPPPPGRLPPPLPHGPPPLPPPPPQGPPPPRGF 72 >UniRef50_A6UHC7 Cluster: Outer membrane autotransporter barrel domain; n=1; Sinorhizobium medicae WSM419|Rep: Outer membrane autotransporter barrel domain - Sinorhizobium medicae WSM419 Length = 864 Score = 39.5 bits (88), Expect = 0.14 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 482 GGVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPP 518 Score = 39.5 bits (88), Expect = 0.14 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 483 GVSPPPPPPPPPPPPPPPPPPSPPPPPPPSPPPPPPP 519 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 496 PPPPPPPPSPPPPPPPSPPPPPPPPPPPPPPP 527 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 498 PPPPPPSPPPPPPPSPPPPPPPPPPPPPPPPP 529 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 494 PPPPPPPPPPSPPPPPPPSPPPPPPPPPPPPP 525 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 495 PPPPPPPPPSPPPPPPPSPPPPPPPPPPPPPP 526 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 497 PPPPPPPSPPPPPPPSPPPPPPPPPPPPPPPP 528 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 490 PPPPPPPPPPPPPPSPPPPPPPSPPPPPPPPP 521 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 491 PPPPPPPPPPPPPSPPPPPPPSPPPPPPPPPP 522 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 492 PPPPPPPPPPPPSPPPPPPPSPPPPPPPPPPP 523 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 499 PPPPPSPPPPPPPSPPPPPPPPPPPPPPPPPP 530 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 500 PPPPSPPPPPPPSPPPPPPPPPPPPPPPPPPP 531 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 501 PPPSPPPPPPPSPPPPPPPPPPPPPPPPPPPP 532 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 502 PPSPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 533 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 503 PSPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 534 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 505 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPGP 536 >UniRef50_Q852P0 Cluster: Pherophorin; n=2; Eukaryota|Rep: Pherophorin - Volvox carteri f. nagariensis Length = 606 Score = 39.5 bits (88), Expect = 0.14 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 245 PPPPPPPSPPPPPPPPSPSPPPPPPSPSPPPP 276 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 246 PPPPPPSPPPPPPPPSPSPPPPPPSPSPPPPP 277 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 254 PPPPPPPSPSPPPPPPSPSPPPPPPPPSPPP 284 Score = 36.7 bits (81), Expect = 0.96 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPPPP PP P F Sbjct: 255 PPPPPPSPSPPPPPPSPSPPPPPPPPSPPPAPPPF 289 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 236 PPPPSPPPPPPPPPPPSPPPPPPPPSPSPPPP 267 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +P PPPP PPPPP PPPP Sbjct: 202 EPQPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 234 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 205 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 235 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 213 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 244 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 217 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 247 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 225 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 256 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 229 PPPPPPPPPPPSPPPPPPPPPPPSPPPPPPP 259 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 234 PPPPPPSPPPPPPPPPPPSPPPPPPPPSPSPP 265 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 214 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 245 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 215 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 246 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 226 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 257 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 227 PSPPPPPPPPPPPSPPPPPPPPPPPSPPPPPP 258 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 206 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 237 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 207 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 238 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 208 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 239 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 210 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 241 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 218 PPPPPPPPPPSPPPPPPPPPPPSPPPPPPPPP 249 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 219 PPPPPPPPPSPPPPPPPPPPPSPPPPPPPPPP 250 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 220 PPPPPPPPSPPPPPPPPPPPSPPPPPPPPPPP 251 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 222 PPPPPPSPPPPPPPPPPPSPPPPPPPPPPPSP 253 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 237 PPPSPPPPPPPPPPPSPPPPPPPPSPSPPPPP 268 >UniRef50_Q6H7U3 Cluster: Putative formin I2I isoform; n=2; Oryza sativa|Rep: Putative formin I2I isoform - Oryza sativa subsp. japonica (Rice) Length = 881 Score = 39.5 bits (88), Expect = 0.14 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP G PPP Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 >UniRef50_A7RXK9 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 534 Score = 39.5 bits (88), Expect = 0.14 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP PPP Sbjct: 395 PPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 425 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 394 PPPPPPPIEGRPPSSLGNPPPPPPPGRGAPPP 425 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP PPP Sbjct: 307 PPPPPSRGAAPPPPSRGAPPPPPSRGSAPPP 337 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PPPPP GPPPP Sbjct: 366 PPPPSMGMAPPPVGGAAPPPPPPPPVGGPPPP 397 >UniRef50_A0BFK7 Cluster: Chromosome undetermined scaffold_104, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_104, whole genome shotgun sequence - Paramecium tetraurelia Length = 1152 Score = 39.5 bits (88), Expect = 0.14 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP K PPPPP PPPP Sbjct: 603 PPPPPPPPPPVKSAPLPPPPPPPKIAAPPPP 633 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP GPPPP Sbjct: 619 PPPPPPP-----KIAAPPPPPPPPMKAGPPPP 645 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 3/37 (8%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPP---XXXGPPPP 512 K PPPPP + PPPPP GPPPP Sbjct: 639 KAGPPPPPPPPGVPRPPGGPPPPPPPPGSKAGGPPPP 675 >UniRef50_P48608 Cluster: Protein diaphanous; n=5; Endopterygota|Rep: Protein diaphanous - Drosophila melanogaster (Fruit fly) Length = 1091 Score = 39.5 bits (88), Expect = 0.14 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP GPPPP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPP 569 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 539 PPPPPPPPMPGRAGGPPPPPPPPGMGGPPPPP 570 >UniRef50_Q9FLQ7 Cluster: Gb|AAD23008.1; n=1; Arabidopsis thaliana|Rep: Gb|AAD23008.1 - Arabidopsis thaliana (Mouse-ear cress) Length = 1289 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP I PPPP PPPP Sbjct: 995 PPPPPPPPFSHVSSIPPPPPPPPMHGGAPPPP 1026 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 943 PPPPPPPPPSYGS--PPPPPPPPPSYGSPPPP 972 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 956 PPPPPPPPPSYGS--PPPPPPPPPGYGSPPPP 985 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 969 PPPPPPPPPGYGS--PPPPPPPPPSYGSPPPP 998 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 670 PPPPPPPFSSERPNSGTVLPPPPP----PPPP 697 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/35 (42%), Positives = 18/35 (51%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP ++ + PPPP PPPP F Sbjct: 790 PPPPPPPPFASVRRNSETLLPPPP----PPPPPPF 820 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 918 PPPPPPPPFSNAHSVLS---PPPPSYGSPPPP 946 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 1010 PPPPPPPPMHGG---APPPPPPPPMHGGAPPP 1038 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 1023 PPPPPPPPMHGG---APPPPPPPPMHGGAPPP 1051 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 1036 PPPPPPPPMHGG---APPPPPPPPMHGGAPPP 1064 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP G PPP Sbjct: 1062 PPPPPPPMFGGAQP-----PPPPPMRGGAPPP 1088 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 649 PPPPPPPLPTYSHYQTSQLPPPPP----PPPP 676 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPPP PPPPP G PPP Sbjct: 1074 QPPPPPPMRGGAPP------PPPPPMRGGAPPP 1100 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 1086 PPPPPPPMRGGAPP-----PPPPPMRGGAPPP 1112 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 1098 PPPPPPPMRGGAPP-----PPPPPMHGGAPPP 1124 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 1110 PPPPPPPMHGGAPP-----PPPPPMRGGAPPP 1136 >UniRef50_Q3HTK4 Cluster: Pherophorin-C3 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C3 protein precursor - Chlamydomonas reinhardtii Length = 443 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 234 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPPPP 265 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 226 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 257 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 228 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 259 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 229 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 260 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 225 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 256 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 227 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 258 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 231 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 262 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 232 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPSPP 263 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 233 PPPPPPPPPSPPPPPPPPPPPPPPPPPPSPPP 264 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 236 PPPPPPSPPPPPPPPPPPPPPPPPPSPPPPSP 267 >UniRef50_Q10R38 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class; n=2; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class - Oryza sativa subsp. japonica (Rice) Length = 209 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPPAASPPPP 102 >UniRef50_Q0DLG0 Cluster: Os05g0104000 protein; n=9; Oryza sativa|Rep: Os05g0104000 protein - Oryza sativa subsp. japonica (Rice) Length = 830 Score = 39.1 bits (87), Expect = 0.18 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP ++ + PPPPP PPPP Sbjct: 78 PPPPPPAPRPPRRHHRIPPPPPPLLPTPPPP 108 >UniRef50_Q015R2 Cluster: RhoA GTPase effector DIA/Diaphanous; n=2; Ostreococcus|Rep: RhoA GTPase effector DIA/Diaphanous - Ostreococcus tauri Length = 1105 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 450 PPPPPPFARAQSANANVSAPPPPPPPPPPPPP 481 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 449 PPPPPPPFARAQSANANVSAPPPPPPPPPPPP 480 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP I P PPP P PP Sbjct: 478 PPPPPPPPRPSLGPIVPTPPAPPPVPRAPVPP 509 >UniRef50_A2F7T1 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 659 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP + PPPPP PPPP + Sbjct: 146 PPPPPPSYAPPPQPPSYQQPPPPPQYQQPPPPPQY 180 >UniRef50_A0E3T6 Cluster: Chromosome undetermined scaffold_77, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_77, whole genome shotgun sequence - Paramecium tetraurelia Length = 1215 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 659 PPPPPPPPPPSKNGAPPPPPPPPPSRNGAPPP 690 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP G PPP Sbjct: 688 PPPPPPPPPP--SKTGAPPPPPPPRIGGAPPP 717 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 675 PPPPPPPPSRNGAPPPPPPPPPPSKTGAPPPP 706 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 672 GAPPPPPPPPPSRNGAP---PPPPPPPPPSKTGAPPP 705 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP K PPPP PPPP Sbjct: 688 PPPPPPPPPPSKTGAPPPPPPPRIGGAPPPP 718 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 642 PPPPPPPPLPNTQ-----VPPPPPPPPPPPPP 668 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPX--XXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 644 PPPPPPLPNTQVPPPPPPPPPPPPPSKNGAPPPP 677 >UniRef50_Q9P6T1 Cluster: Putative uncharacterized protein 15E6.220; n=1; Neurospora crassa|Rep: Putative uncharacterized protein 15E6.220 - Neurospora crassa Length = 1992 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/34 (44%), Positives = 17/34 (50%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 ++PPPPPP PPPPP PPPP Sbjct: 40 QQPPPPPPPPPASPPPPPPPPPPPPPPPPPPPPP 73 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 44 PPPPPPPASPPPPPPPPPPPPPPPPPPPPPEP 75 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 1950 PPPPPPPPPPTE---DPPPPPPPPPAEAPPPP 1978 >UniRef50_Q4PGR6 Cluster: Putative uncharacterized protein; n=1; Ustilago maydis|Rep: Putative uncharacterized protein - Ustilago maydis (Smut fungus) Length = 633 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 48 PPPPPPDMAFDQAQNSDIVPPPPPSSMPPPPP 79 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 47 PPPPPPPDMAFDQAQNSDIVPPPPPSSMPPPP 78 >UniRef50_A3GHT1 Cluster: Predicted protein; n=3; Saccharomycetaceae|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 1790 Score = 39.1 bits (87), Expect = 0.18 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 1133 PPPPPPPFPTSLVQNGSGGPPPPPPPPPPPPP 1164 >UniRef50_Q8TF74 Cluster: WAS/WASL-interacting protein family member 2; n=10; Eutheria|Rep: WAS/WASL-interacting protein family member 2 - Homo sapiens (Human) Length = 440 Score = 39.1 bits (87), Expect = 0.18 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPP--XXXGPPPP 512 G PPPPPP + + PPPPP GPPPP Sbjct: 335 GARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPP 373 >UniRef50_Q4S986 Cluster: Chromosome 3 SCAF14700, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF14700, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1204 Score = 38.7 bits (86), Expect = 0.24 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 606 GVPPPPPPPPPPPALGAMGAPPPPPPPPPSAAGLPPP 642 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPP GPPPP Sbjct: 649 GAGPPPPPPPPLPGAG----PPPPPPPPLSGAGPPPP 681 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPP GPPPP Sbjct: 624 GAPPPPPPPPPSAAG-----LPPPPPPPLPGAGPPPP 655 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP GPPPP Sbjct: 640 PPPPPPPLPGAG---PPPPPPPPLPGAGPPPP 668 >UniRef50_Q4RLQ7 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 579 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 404 PPPPPPPPPPGLPGAGPPPPPPPPGCGPPPPP 435 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 374 PPPPPPPPLPGNTGAPPPPPPPPPLPGGGPPP 405 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 G PPPPPP PPPP PPPP F Sbjct: 400 GGGPPPPPPPPPPPGLPGAGPPPPPPPPGCGPPPPPPMGSF 440 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPP GPPPP Sbjct: 387 GAPPPPPPPPPLPGGGPPPPPPPPPPPGLPGAGPPPP 423 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP GPPPP Sbjct: 359 PPPPPP-------------PPPPPGFLGPPPP 377 >UniRef50_Q2W222 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 1274 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 279 PPPPPPPPPPPPPSPPAPAPPPPPPAPPPPPP 310 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 277 PPPPPPPPPPPPPPPSPPAPAPPPPPPAPPPP 308 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 284 PPPPPPPPSPPAPAPPPPPPAPPPPPPAPPPP 315 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 278 PPPPPPPPPPPPPPSPPAPAPPPPPPAPPPPP 309 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 286 PPPPPPSPPAPAPPPPPPAPPPPPPAPPPPAP 317 >UniRef50_Q3HTK5 Cluster: Pherophorin-C2 protein precursor; n=8; Chlamydomonadales|Rep: Pherophorin-C2 protein precursor - Chlamydomonas reinhardtii Length = 853 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 255 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 286 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 256 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 287 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 274 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 305 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 331 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 362 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 346 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 377 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 375 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 406 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 390 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 421 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 445 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 476 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 460 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 491 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 489 PPPPPPSPPPPPPPSPPPPPPPSPPPPSPPPP 520 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 504 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 535 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 428 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 458 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 436 PPPPPPPSPPPPPPPSPPPPPPPSPPPPPPP 466 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 237 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 268 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 238 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 269 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 264 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 295 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 282 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 313 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 289 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPSP 320 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 290 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPSPP 321 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 311 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 342 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 312 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 343 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 313 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 344 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 321 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 352 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 347 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 378 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 355 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 386 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 356 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 387 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 357 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 388 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 365 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 396 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 409 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 440 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 410 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 441 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 411 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 442 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 419 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 450 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 461 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 492 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 469 PPPSPPPPSPPPPSPPPPSPPPPPPPSPPPPP 500 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 470 PPSPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 501 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 471 PSPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 502 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 479 PPPSPPPPSPPPPPPPSPPPPPPPSPPPPPPP 510 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 263 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 294 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 281 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 312 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 320 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 351 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 364 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 395 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 418 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 449 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 425 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 456 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 426 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 457 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 433 PPSPPPPPPPSPPPPPPPSPPPPPPPSPPPPP 464 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 434 PSPPPPPPPSPPPPPPPSPPPPPPPSPPPPPP 465 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 478 PPPPSPPPPSPPPPPPPSPPPPPPPSPPPPPP 509 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/34 (44%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPP--PPPXXXGPPPP 512 PPPPPP PP PPP PPPP Sbjct: 308 PPPPPPSPPPPSPPPPSPPPPSPPPPPPPSPPPP 341 >UniRef50_Q3HTK2 Cluster: Pherophorin-C5 protein precursor; n=1; Chlamydomonas reinhardtii|Rep: Pherophorin-C5 protein precursor - Chlamydomonas reinhardtii Length = 541 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 183 PPPPPPPSPPPPSPPPPSPPPPPPPSPPPPPP 214 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 184 PPPPPPSPPPPSPPPPSPPPPPPPSPPPPPPP 215 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 209 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 240 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 176 PPPPPPSPPPPPPPSPPPPSPPPPSPPPPPPP 207 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 210 PPPPPPSPPPPSPPPPSPPPPSPPPPSPPPPP 241 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 175 PPPPPPPSPPPPPPPSPPPPSPPPPSPPPPPP 206 >UniRef50_P93797 Cluster: Pherophorin-S precursor; n=1; Volvox carteri|Rep: Pherophorin-S precursor - Volvox carteri Length = 599 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 238 PPPPPPPPPPSPPPSPPPPPPPPPPPPPPPPP 269 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 239 PPPPPPPPPSPPPSPPPPPPPPPPPPPPPPPP 270 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 240 PPPPPPPPSPPPSPPPPPPPPPPPPPPPPPPP 271 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 291 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 262 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 293 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 263 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 294 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 264 PPPPPPPPPPPPSPPPPPPPPPPPPPPPPPPP 295 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPPPP PPPP + Sbjct: 270 PPPPPPSPPPPPPPPPPPPPPPPPPPPPPPPPPVY 304 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 241 PPPPPPPSPPPSPPPPPPPPPPPPPPPPPPPP 272 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 242 PPPPPPSPPPSPPPPPPPPPPPPPPPPPPPPP 273 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 258 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 289 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 259 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 290 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 261 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 292 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 265 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPPP 296 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 266 PPPPPPPPPPSPPPPPPPPPPPPPPPPPPPPP 297 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 267 PPPPPPPPPSPPPPPPPPPPPPPPPPPPPPPP 298 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 268 PPPPPPPPSPPPPPPPPPPPPPPPPPPPPPPP 299 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 269 PPPPPPPSPPPPPPPPPPPPPPPPPPPPPPPP 300 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 236 PSPPPPPPPPPPSPPPSPPPPPPPPPPPPPPP 267 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 249 PPPSPPPPPPPPPPPPPPPPPPPPPPPSPPPP 280 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 234 PPPSPPPPPPPPPPSPPPSPPPPPPPPPPPPP 265 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 235 PPSPPPPPPPPPPSPPPSPPPPPPPPPPPPPP 266 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 253 PPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 283 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 226 PPPPPPPSPPPSPPPPPPPPPPSPPPSPPPPP 257 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 227 PPPPPPSPPPSPPPPPPPPPPSPPPSPPPPPP 258 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 244 PPPPSPPPSPPPPPPPPPPPPPPPPPPPPPPP 275 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 250 PPSPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 281 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 251 PSPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 282 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 254 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 285 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 286 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 256 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 287 >UniRef50_A7SGL4 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 620 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 430 PPPPPPPPPPCPVPCPPPPPPPPPSPPPPPPP 461 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP PPPP Sbjct: 429 PPPPPPPPPPPCPVPCPPPPPPPPPSPPPPP 459 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 431 PPPPPPPPPCPVPCPPPPPPPPPSPPPPPPPP 462 >UniRef50_Q3HYB9 Cluster: Proline-and threonine-rich protein; n=2; Coccidioides|Rep: Proline-and threonine-rich protein - Coccidioides posadasii Length = 281 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP K PPPPP PPPP Sbjct: 124 PPPPPPPPPPAPTTSKAAPPPPPPPPPPPPP 154 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP P PP Sbjct: 126 PPPPPPPPAPTTSKAAPPPPPPPPPPPPPAPP 157 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + + PPPPP PPPP Sbjct: 106 PPPPPPPPAPTTTQAPQYPPPPPP----PPPP 133 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 124 PPPPPPPPPPAPTTSKAAPPPPPPPPPPPPP 154 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 128 PPPPPPAPTTSKAAPPPPPPPPPPPPPAPPAP 159 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 125 PPPPPPPPPAPTTSKAAPPPPPPPPPPPPPAP 156 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPP PPPPP PPPP Sbjct: 81 KAPPPPQSPPAPTTTAQAPPPPPPPPPPPPPPP 113 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP K K PPP P P P F Sbjct: 147 PPPPPPPPAPPAPKPSKPAPPPQPPTELPDPSKQVF 182 >UniRef50_A5DRR5 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 996 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 943 PPPPPPPPPPSLIPFGASPPPPPPPPPPPPPP 974 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 946 PPPPPPPSLIPFGASPPPPPPPPPPPPPPPP 976 >UniRef50_A4R506 Cluster: Putative uncharacterized protein; n=1; Magnaporthe grisea|Rep: Putative uncharacterized protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 536 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 434 PPPPPPPPPPPPSPPAPPPPPPPPVITPPPPP 465 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 435 PPPPPPPPPPPSPPAPPPPPPPPVITPPPPPP 466 >UniRef50_P21997 Cluster: Sulfated surface glycoprotein 185 precursor; n=1; Volvox carteri|Rep: Sulfated surface glycoprotein 185 precursor - Volvox carteri Length = 485 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 261 PPPPPPPPPPPPPPPPSPPPPPPPPPPPPPPP 292 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 263 PPPPPPPPPPPPPPSPPPPPPPPPPPPPPPPP 294 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 264 PPPPPPPPPPPPPSPPPPPPPPPPPPPPPPPP 295 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 260 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 291 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 262 PPPPPPPPPPPPPPPSPPPPPPPPPPPPPPPP 293 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PP PPP PPPPP PPPP Sbjct: 249 RPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPP 281 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PP PPP PPPPP PPPP Sbjct: 240 RPPSPPPSPRPPSPPPPSPSPPPPPPPPPPPPP 272 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 269 PPPPPPPPSPPPPPPPPPPPPPPPPPPSPSPP 300 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 + P PPPP PPPPP PPPP Sbjct: 249 RPPSPPPPSPSPPPPPPPPPPPPPPPPPSPPPPP 282 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 253 PPPPSPSPPPPPPPPPPPPPPPPPSPPPPPPP 284 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 266 PPPPPPPPPPPSPPPPPPPPPPPPPPPPPPSP 297 >UniRef50_Q9S8M0 Cluster: Chitin-binding lectin 1 precursor; n=1; Solanum tuberosum|Rep: Chitin-binding lectin 1 precursor - Solanum tuberosum (Potato) Length = 323 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 175 PPPPPPSPPPPSPPPPSPSPPPPPASPPPPPP 206 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 154 PPPPPPSPPPPSPPSPPPPSPPPPPPPSPPPP 185 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 174 PPPPPPPSPPPPSPPPPSPSPPPPPASPPPPP 205 >UniRef50_O95466 Cluster: Formin-like protein 1; n=39; Tetrapoda|Rep: Formin-like protein 1 - Homo sapiens (Human) Length = 1100 Score = 38.7 bits (86), Expect = 0.24 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 G PPPPPP + PPPPP GPP Sbjct: 582 GDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 616 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP G PP Sbjct: 586 PPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 616 >UniRef50_Q54YX8 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 456 Score = 29.9 bits (64), Expect(2) = 0.31 Identities = 11/26 (42%), Positives = 13/26 (50%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPP 488 ++PPPPPP PPPPP Sbjct: 53 QQPPPPPPSQQHHLNYHNTSTPPPPP 78 Score = 27.5 bits (58), Expect(2) = 0.31 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 474 PPPPPXXXGPPPP 512 PPPPP PPPP Sbjct: 110 PPPPPPTVPPPPP 122 Score = 27.5 bits (58), Expect(2) = 9.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 474 PPPPPXXXGPPPP 512 PPPPP PPPP Sbjct: 111 PPPPPTVPPPPPP 123 Score = 24.6 bits (51), Expect(2) = 9.8 Identities = 9/26 (34%), Positives = 11/26 (42%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPP 488 ++ PPPPP PPPP Sbjct: 52 QQQPPPPPPSQQHHLNYHNTSTPPPP 77 >UniRef50_UPI00015B541C Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 661 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 64 PPPPPPPVTYNYPAPPPPPPPPPPPPPPPPPP 95 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 65 PPPPPPVTYNYPAPPPPPPPPPPPPPPPPPPP 96 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PP PPP PPPPP PPPP Sbjct: 60 QPPSPPPPPPPVTYNYPAPPPPPPPPPPPPPPP 92 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 62 PSPPPPPPPVTYNYPAPPPPPPPPPPPPPPPP 93 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 66 PPPPPVTYNYPAPPPPPPPPPPPPPPPPPPPP 97 >UniRef50_UPI0000DB6CCB Cluster: PREDICTED: hypothetical protein; n=1; Apis mellifera|Rep: PREDICTED: hypothetical protein - Apis mellifera Length = 394 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 234 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 265 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 235 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 266 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 236 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 267 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 237 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 268 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 238 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 269 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 239 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 270 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 240 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 271 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 246 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 277 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 278 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPPPPPPPPLPPPPPPP 279 Score = 37.5 bits (83), Expect = 0.55 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 245 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 276 Score = 37.5 bits (83), Expect = 0.55 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 255 PPPPPPPPPPPPPPPPPLPPPPPPPPPLPPPP 286 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 257 PPPPPPPPPPPPPPPLPPPPPPPPPLPPPPP 287 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 244 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 275 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 254 PPPPPPPPPPPPPPPPPPLPPPPPPPPPLPPP 285 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 261 PPPPPPPPPPPL-----PPPPPPPPPLPPPPP 287 >UniRef50_Q4RLL2 Cluster: Chromosome 10 SCAF15019, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 10 SCAF15019, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1225 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 721 PPPPPPPKAATPPPPKAVTPPPPPKAVTPPPP 752 Score = 37.5 bits (83), Expect = 0.55 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPP PPPP Sbjct: 712 PPPPPPKAAPPPPPPPKAATPPPPKAVTPPPP 743 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 740 PPPPPKAVTPPPPPKAVTPPPPPKAVTPPPP 770 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 749 PPPPPKAVTPPPPPKAVTPPPPPKAVTPPPP 779 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXP--PPPPXXXGPPPP 512 PPPPPP + P PPPP PPPP Sbjct: 647 PPPPPPEKPSKLRGNSPLPPDIPPPPPYTAPPPP 680 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PP + K PPPPP PPPP Sbjct: 694 PSPPKNVTPPPISVQKVIPPPPPPKAAPPPP 724 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPP PPPPP PPPP Sbjct: 728 KAATPPPPKAVTPPPPPKAVTPPPPPKAVTPPPP 761 >UniRef50_A4FGR9 Cluster: Putative uncharacterized protein; n=1; Saccharopolyspora erythraea NRRL 2338|Rep: Putative uncharacterized protein - Saccharopolyspora erythraea (strain NRRL 23338) Length = 373 Score = 38.3 bits (85), Expect = 0.31 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + + PPPP PPPP Sbjct: 262 PPPPPPPPPPTPEPVPPPPIPPPPPVPAPPPP 293 Score = 37.9 bits (84), Expect = 0.42 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 263 PPPPPPPPPTPEPVPPPPIPPPPPVPAPPPPP 294 >UniRef50_Q4U2V7 Cluster: Hydroxyproline-rich glycoprotein GAS31 precursor; n=2; Chlamydomonas reinhardtii|Rep: Hydroxyproline-rich glycoprotein GAS31 precursor - Chlamydomonas reinhardtii Length = 647 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 247 PPPPPPPPPPPPPPPPPPSPPPPPPPPPPPPP 278 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 248 PPPPPPPPPPPPPPPPPSPPPPPPPPPPPPPP 279 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 222 PPPPPSASSPPSSPSPSPRPPPPPMPPPPPPP 253 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 241 PPPPPMPPPPPPPPPPPPPPPPPPSPPPPPP 271 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 239 PRPPPPPMPPPPPPPPPPPPPPPPPPSPPPPP 270 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 255 PPPPPPPPPPSPPPPPPPPPPPPPPLLPPLPP 286 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 254 PPPPPPPPPPPSPPPPPPPPPPPPPPLLPPLP 285 >UniRef50_Q4PSF3 Cluster: Proline-rich extensin-like family protein; n=3; Arabidopsis thaliana|Rep: Proline-rich extensin-like family protein - Arabidopsis thaliana (Mouse-ear cress) Length = 249 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPP PPPPP PPPP F Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLF 159 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 44 PPPPPVNISSPPPPVNLSPPPPPVNLSPPPP 74 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 62 PPPPPVNLSPPPPPVNLSPPPPPVNLSPPPP 92 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 71 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP 101 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 89 PPPPPVLLSPPPPPVNLSPPPPPVNLSPPPP 119 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 98 PPPPPVNLSPPPPPVNLSPPPPPVLLSPPPP 128 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPP + PPPP PPPP F Sbjct: 125 PPPPPVLLSPPPPPVNLSPPPPPVLLSPPPPPVLF 159 Score = 34.7 bits (76), Expect = 3.9 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 G PPPPPP K + PPPPP G PPPP Sbjct: 202 GRVYPPPPPPPQAARSYK---RSPPPPPPSKYGRVYSPPPP 239 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PPPPP PPPP Sbjct: 54 PPPPVNLSPPPPPVNLSPPPPPVNLSPPPP 83 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPP PPPP Sbjct: 152 PPPPPVLFSPPPPTVTRPPPPPTITRSPPPP 182 >UniRef50_Q01I59 Cluster: H0315A08.9 protein; n=3; Oryza sativa|Rep: H0315A08.9 protein - Oryza sativa (Rice) Length = 168 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 28 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 59 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 29 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 60 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 30 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 61 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 31 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 62 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 32 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 63 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 33 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 64 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 34 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 65 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 35 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 66 >UniRef50_A5B0K8 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 324 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PP PPP PPPPP GPPPP + Sbjct: 46 PPGPPPPSWHHPPPPDPFAPPPPPGPPGPPPPGPY 80 >UniRef50_Q7PNI8 Cluster: ENSANGP00000013088; n=1; Anopheles gambiae str. PEST|Rep: ENSANGP00000013088 - Anopheles gambiae str. PEST Length = 157 Score = 38.3 bits (85), Expect = 0.31 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPP + PPPPP GPPP Sbjct: 45 PPPPPRPVYGPPPVHHAPPPPPPPAYGPPP 74 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 106 PPPPPPPRPVYGPPPQQSYGPPPPVHHAPPPP 137 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPP-----PPPXXXGPPPP 512 PPPPPP + PP PPP GPPPP Sbjct: 63 PPPPPPAYGPPPAPVYGPPPPQSYGPPPPQSYGPPPP 99 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 107 PPPPPPRPVYGPPPQQSYGPPPPVHHAPPPPP 138 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPPP GPPPP + Sbjct: 62 PPPPPPPAYGPPP--APVYGPPPPQSYGPPPPQSY 94 >UniRef50_Q75JU4 Cluster: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein; n=2; Dictyostelium discoideum|Rep: Similar to Volvox carteri f. nagariensis. Pherophorin-dz1 protein - Dictyostelium discoideum (Slime mold) Length = 243 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 62 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 93 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 94 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 95 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 96 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 66 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 97 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 98 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 99 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 100 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 70 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 101 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 76 PPPPPPPPPPPPPPPPPPPPPPPPPPLPPPPP 107 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 77 PPPPPPPPPPPPPPPPPPPPPPPPPLPPPPPP 108 Score = 37.5 bits (83), Expect = 0.55 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 75 PPPPPPPPPPPPPPPPPPPPPPPPPPPLPPPP 106 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 59 PPAPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 90 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 60 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 91 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 55 PPPLPPAPPPPPPPPPPPPPPPPPPPPPPPPP 86 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 74 PPPPPPPPPPPPPPPPPPPPPPPPPPPPLPPP 105 >UniRef50_Q54SP2 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1126 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP GPPPP Sbjct: 562 PPPPPPPPPPSSGGGPPPPPPPPSSGGPPPP 592 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 543 GAPPPPPPPPPAPPVSGGGPPPPPPPPPPSSGGGPPP 579 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 560 GGPPPPPPPPPPSSGGGPP-----PPPPPPSSGGPPP 591 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 562 PPPPPPPPPPSSGGGPPPPPPPPSSGGPPPPP 593 >UniRef50_A0DJB7 Cluster: Chromosome undetermined scaffold_53, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_53, whole genome shotgun sequence - Paramecium tetraurelia Length = 1117 Score = 38.3 bits (85), Expect = 0.31 Identities = 18/41 (43%), Positives = 19/41 (46%), Gaps = 4/41 (9%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPPXXF 521 K PPPPP +K PPPPP G PPPP F Sbjct: 603 KTGPPPPPPPPLPGQKAGAPPPPPPPPPPGQKGIPPPPPTF 643 Score = 37.5 bits (83), Expect = 0.55 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP K PPPPP PPP Sbjct: 542 PPPPPPPPPPPLPGQHKQTPPPPPPPPPPPP 572 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/33 (48%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPP-PPXXXGPPPP 512 PPPPPP +K PPP P GPPPP Sbjct: 564 PPPPPPPPPLPGQKTGPPPPPPLPGQKAGPPPP 596 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + + PPPPP PPPP Sbjct: 543 PPPPPPPPPPLPGQHKQTPPPPPPPP--PPPP 572 >UniRef50_A0D1C0 Cluster: Chromosome undetermined scaffold_34, whole genome shotgun sequence; n=2; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_34, whole genome shotgun sequence - Paramecium tetraurelia Length = 1131 Score = 38.3 bits (85), Expect = 0.31 Identities = 17/35 (48%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP---XXXGPPPP 512 PPPPPP K PPPPP GPPPP Sbjct: 632 PPPPPPPPPPPGGKTGAPPPPPPPPGAKAGGPPPP 666 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP K PPPPP PPPP Sbjct: 614 PPPPPPPPSVPKSTNNSAPPPPPPP--PPPP 642 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG-----PPPP 512 PPPPPP PPPPP G PPPP Sbjct: 616 PPPPPPSVPKSTNNSAPPPPPPPPPPPGGKTGAPPPP 652 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP------XXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 598 PPPPPPPPPPSAKSQVPPPPPPPPSVPKSTNNSAPPPP 635 >UniRef50_Q0U6P9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 349 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 56 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 87 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 57 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 88 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXX---KKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 34 PPPPPPAPRVAGFSYPQTFMASPPPPPPPPPPPPP 68 >UniRef50_P21260 Cluster: Uncharacterized proline-rich protein; n=1; Owenia fusiformis|Rep: Uncharacterized proline-rich protein - Owenia fusiformis Length = 141 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 9 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 40 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 10 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 41 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 11 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 42 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 12 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 43 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 13 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 44 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 14 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 45 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 15 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 46 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 16 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 47 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 17 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 48 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 18 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 49 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 19 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 50 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 20 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 51 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 21 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 52 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 22 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 53 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 23 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 54 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 24 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 55 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 25 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 56 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 26 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 57 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 27 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 58 >UniRef50_P12978 Cluster: Epstein-Barr nuclear antigen 2; n=2; Human herpesvirus 4|Rep: Epstein-Barr nuclear antigen 2 - Epstein-Barr virus (strain B95-8) (HHV-4) (Human herpesvirus 4) Length = 487 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 63 PPPPPPPPPPPPPPPPPPPPPPPPPPSPPPPP 94 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 64 PPPPPPPPPPPPPPPPPPPPPPPPPSPPPPPP 95 Score = 38.3 bits (85), Expect = 0.31 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 65 PPPPPPPPPPPPPPPPPPPPPPPPSPPPPPPP 96 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 67 PPPPPPPPPPPPPPPPPPPPPPSPPPPPPPPP 98 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 68 PPPPPPPPPPPPPPPPPPPPPSPPPPPPPPPP 99 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 69 PPPPPPPPPPPPPPPPPPPPSPPPPPPPPPPP 100 >UniRef50_UPI0000F1EA7E Cluster: PREDICTED: similar to LOC495114 protein; n=2; Danio rerio|Rep: PREDICTED: similar to LOC495114 protein - Danio rerio Length = 904 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/41 (39%), Positives = 16/41 (39%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 G PPPPPP PPPPP PPP F Sbjct: 330 GLFSPPPPPPPPPPGFAGLASPPPPPPPPGGLSIPPPPGLF 370 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/43 (39%), Positives = 18/43 (41%), Gaps = 6/43 (13%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXG------PPPP 512 G PPPPPP + PPPPP G PPPP Sbjct: 312 GLGSAPPPPPPPPPPGPAGLFSPPPPPPPPPPGFAGLASPPPP 354 >UniRef50_UPI0000E4919E Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 2051 Score = 37.9 bits (84), Expect = 0.42 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP P PP Sbjct: 1971 PPPPPPPSEDLRSSAYRKSPPPPPPPDTPAPP 2002 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/36 (41%), Positives = 15/36 (41%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP K PPPPP PP F Sbjct: 1972 PPPPPPSEDLRSSAYRKSPPPPPPPDTPAPPKDDSF 2007 >UniRef50_UPI0000E4896A Cluster: PREDICTED: similar to CG33556-PA; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to CG33556-PA - Strongylocentrotus purpuratus Length = 1472 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 432 GVGAPPPPPPPPPPPLPGGSCIPPPPPPPGMGGAPPP 468 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 438 PPPPPPPPPLPGGSCIPPPPPPPGMGGAPPPP 469 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG---PPPP 512 PPPPPP PPPPP G PPPP Sbjct: 423 PPPPPPLPPGVGAPPPPPPPPPPPLPGGSCIPPPP 457 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 454 PPPPPPPGMGG----APPPPPPPPFPGGVPPP 481 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 461 GMGGAPPPPPPPPFPGG------VPPPPPLPGGAPPP 491 >UniRef50_UPI00006A19F8 Cluster: UPI00006A19F8 related cluster; n=2; Xenopus tropicalis|Rep: UPI00006A19F8 UniRef100 entry - Xenopus tropicalis Length = 389 Score = 37.9 bits (84), Expect = 0.42 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPPP PPPPP PPPP Sbjct: 15 EPPPPPPGKESNLPVKKGTSPPPPPPVKPPPPP 47 >UniRef50_A3PW04 Cluster: U5 snRNP spliceosome subunit-like protein precursor; n=5; Mycobacterium|Rep: U5 snRNP spliceosome subunit-like protein precursor - Mycobacterium sp. (strain JLS) Length = 137 Score = 37.9 bits (84), Expect = 0.42 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 86 PPPPPPPPPGAPPPPPPPPPPPPPPVYVPPPP 117 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 85 PPPPPPPPPPGAPPPPPPPPPPPPPPVYVPPP 116 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPPPP PPPP + Sbjct: 83 PPPPPPPPPPPP-----GAPPPPPPPPPPPPPPVY 112 >UniRef50_Q9SNE9 Cluster: Putative uncharacterized protein F11C1_20; n=5; Arabidopsis thaliana|Rep: Putative uncharacterized protein F11C1_20 - Arabidopsis thaliana (Mouse-ear cress) Length = 588 Score = 37.9 bits (84), Expect = 0.42 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPP PP ++ PPPPP PPPP Sbjct: 5 GTIPPPPPLPPRLELRRQRAPPPQPPPPPPPPPPPPP 41 >UniRef50_P93845 Cluster: Putative uncharacterized protein; n=1; Pisum sativum|Rep: Putative uncharacterized protein - Pisum sativum (Garden pea) Length = 306 Score = 37.9 bits (84), Expect = 0.42 Identities = 14/34 (41%), Positives = 16/34 (47%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 ++ PPPPP PPPPP PPPP Sbjct: 67 RRSPPPPPRRSPPPPPRRSSPPPPPPRIRSPPPP 100 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/38 (36%), Positives = 17/38 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 ++ PPPPP + PPPP PPPP F Sbjct: 75 RRSPPPPPRRSSPPPPPPRIRSPPPPRPPPPPPPPLLF 112 >UniRef50_Q54JT5 Cluster: Component of SCAR regulatory complex; n=2; Dictyostelium discoideum|Rep: Component of SCAR regulatory complex - Dictyostelium discoideum AX4 Length = 1336 Score = 37.9 bits (84), Expect = 0.42 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP I PPPPP PPPP Sbjct: 1303 PPPPPMAEYEMSSSIDDFAPPPPPPFGMPPPP 1334 >UniRef50_A0CS42 Cluster: Chromosome undetermined scaffold_26, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 37.9 bits (84), Expect = 0.42 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP K PPPP PPPP Sbjct: 280 GGAPPPPPPPPPPPPPPPPPPKGVPPPPRGPPPPPPP 316 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/34 (44%), Positives = 17/34 (50%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPPPP ++ PPP P G PPPP Sbjct: 253 PPPPPPPPSKQQQQQQVVPPPPAPSAKGGAPPPP 286 >UniRef50_P78621 Cluster: Cytokinesis protein sepA; n=14; Fungi/Metazoa group|Rep: Cytokinesis protein sepA - Emericella nidulans (Aspergillus nidulans) Length = 1790 Score = 37.9 bits (84), Expect = 0.42 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 1039 PPPPPPPGAGAAPPPPPPPPPPPPGGLGGPPP 1070 Score = 37.9 bits (84), Expect = 0.42 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP GPPPP Sbjct: 1040 PPPPPPGAGAAPPPPPPPPPPPPGGLGGPPPP 1071 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/41 (41%), Positives = 18/41 (43%), Gaps = 4/41 (9%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPP----XXXGPPPP 512 G PPPPPP + PPPPP GPPPP Sbjct: 1046 GAGAAPPPPPPPPPPPPGGLGGPPPPPPPPPPGGFGGPPPP 1086 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP PPPPP G PPPP Sbjct: 1019 PPPPPPAHPGLSGAAPPPPPPPPPPPPGAGAAPPPP 1054 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 1018 PPPPPPPAHPGLSGAAPPPPPPPP----PPPP 1045 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPP + PPPPP PPP Sbjct: 1016 PPPPPPPPPAHPGLSGAAPPPPPPPPPPPP 1045 >UniRef50_UPI0000D56E18 Cluster: PREDICTED: hypothetical protein; n=1; Tribolium castaneum|Rep: PREDICTED: hypothetical protein - Tribolium castaneum Length = 288 Score = 37.5 bits (83), Expect = 0.55 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP K+ PPPPP PPP Sbjct: 155 PPPPPEFLLNESKVAPPPPPPPPQVNHTPPP 185 >UniRef50_Q8W5K6 Cluster: Putative uncharacterized protein OSJNBa0079B05.10; n=4; Oryza sativa|Rep: Putative uncharacterized protein OSJNBa0079B05.10 - Oryza sativa (Rice) Length = 1269 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 546 PPPPPPPPPSGNKPAFSPPPPPPPP---PPPP 574 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG---PPPP 512 PPPPPP + + PPPPP PPPP Sbjct: 603 PPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPP 637 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 566 PPPPPPPPPLPQSNYASSQPPPPP----PPPP 593 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGP----PPP 512 PPPPPP + PPPPP P PPP Sbjct: 618 PPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPP 653 >UniRef50_Q8H9E1 Cluster: Extensin; n=6; Eukaryota|Rep: Extensin - Solanum tuberosum (Potato) Length = 152 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 2/36 (5%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPP--XXXGPPPP 512 K PPPPPP + K PPPP PPPP Sbjct: 66 KSPPPPPPVYKSPPPPVYKYKSPPPPVYKYKSPPPP 101 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPP P K PPPPP PPPP Sbjct: 50 KSPPPPSPSPPPPY--YYKSPPPPPPVYKSPPPP 81 >UniRef50_Q7JP75 Cluster: Cytokinesis defect protein 1, isoform b; n=6; cellular organisms|Rep: Cytokinesis defect protein 1, isoform b - Caenorhabditis elegans Length = 1437 Score = 37.5 bits (83), Expect = 0.55 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 742 PPPPPPPGGLPPISGGPPPPPPPPGGCPPPPP 773 >UniRef50_Q4QE97 Cluster: Formin, putative; n=3; Leishmania|Rep: Formin, putative - Leishmania major Length = 1300 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/37 (45%), Positives = 18/37 (48%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G K+PPPPPP PPPP GPPPP Sbjct: 658 GGPKQPPPPPPPPPPPPPP----PPPPPRMGNGPPPP 690 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP + PPPPP PPPP Sbjct: 646 PPPHPPGLPPPTGGPKQPPPPPPPPPPPPPPP 677 >UniRef50_Q38EF1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 576 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP K PPPPP G PPPP Sbjct: 369 PPPPPPGGLRPPGKAPPPPPPPPPMFAGKMKAPPPP 404 Score = 37.1 bits (82), Expect = 0.73 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP PP P Sbjct: 530 PPPPPPKAPPPKGPPPKVAPPPPPPPPPPPAP 561 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPPP K+ PPPPP PP P Sbjct: 382 KAPPPPPPPPPMFAGKM--KAPPPPPIKAPPPMP 413 >UniRef50_A2DFC2 Cluster: Formin Homology 2 Domain containing protein; n=2; Eukaryota|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1189 Score = 37.5 bits (83), Expect = 0.55 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP G PPP Sbjct: 670 PPPPPPGGVPPPPPPPGGVPPPPPPPGGVPPP 701 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPP PPPPP PPPP Sbjct: 666 GLVPPPPPPPGGVPPPPPPPGGVPPPPPPPGGVPPPP 702 >UniRef50_A0BLV2 Cluster: Chromosome undetermined scaffold_115, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_115, whole genome shotgun sequence - Paramecium tetraurelia Length = 1084 Score = 37.5 bits (83), Expect = 0.55 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 571 PPPPPPPPGGSLTAPPPPPPPPPPGGRLPPPP 602 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP PPP Sbjct: 548 PPPPPPPPPPPPGGLLTAPPPPPPPPPPPPP 578 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP PPPP Sbjct: 580 GSLTAPPPPPPPPPPGGR--LPPPPPPPPGGMPPPPP 614 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 572 PPPPPPPGGSLTAPPPPPPPPPPGGRLPPPPP 603 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG-----PPPP 512 PPPPPP PPPPP G PPPP Sbjct: 552 PPPPPPPPGGLLTAPPPPPPPPPPPPPGGSLTAPPPP 588 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 561 GLLTAPPPPPPPPPPPPPGGSLTAPPPPPP---PPPP 594 >UniRef50_Q0CQD0 Cluster: Predicted protein; n=1; Aspergillus terreus NIH2624|Rep: Predicted protein - Aspergillus terreus (strain NIH 2624) Length = 313 Score = 37.5 bits (83), Expect = 0.55 Identities = 17/37 (45%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP GPPPP Sbjct: 138 GPPPPPPPPPPPPPPPPPPPPMAGPPPPP---GPPPP 171 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 145 PPPPPPPPPPPPPPMAGPPPPPGPPPPHPPPP 176 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PP PPP PP PP GPPPP Sbjct: 184 GPPVPPPHPPPAEPAPPPPPAPQGPPAPPPVEGPPPP 220 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%), Gaps = 1/32 (3%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPP-PPXXXGPPP 509 PPPPPP PPP PP GPPP Sbjct: 150 PPPPPPPPPMAGPPPPPGPPPPHPPPPAGPPP 181 >UniRef50_A6R957 Cluster: Cytokinesis protein sepA; n=1; Ajellomyces capsulatus NAm1|Rep: Cytokinesis protein sepA - Ajellomyces capsulatus NAm1 Length = 1670 Score = 37.5 bits (83), Expect = 0.55 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP GPPPP Sbjct: 953 PPPPPPPPPGVG---GPPPPPPPPGMGGPPPP 981 >UniRef50_Q4RE14 Cluster: Chromosome undetermined SCAF15155, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF15155, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 334 Score = 37.1 bits (82), Expect = 0.73 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP + + PPPPP PPPP Sbjct: 253 PPPAPPARSPTTELSSRIPPPPPPPPPPPPPP 284 >UniRef50_Q8W0F9 Cluster: C2 domain-containing protein-like; n=3; Oryza sativa|Rep: C2 domain-containing protein-like - Oryza sativa subsp. japonica (Rice) Length = 327 Score = 37.1 bits (82), Expect = 0.73 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 + PPPP P PPPPP PPPP Sbjct: 188 RSPPPPEPQYPPPSSSPYYFPPPPPPAYSAPPPP 221 >UniRef50_A4RW22 Cluster: Predicted protein; n=1; Ostreococcus lucimarinus CCE9901|Rep: Predicted protein - Ostreococcus lucimarinus CCE9901 Length = 643 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP + PPPPP PPPP F Sbjct: 47 PPPPPPKATAARRA---PPPPPPPPKRQPPPPPPF 78 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP + PPPPP PPPP Sbjct: 45 PSPPPPPPKATAARRAPPPPPPPPKRQPPPPP 76 >UniRef50_A2YBN5 Cluster: Putative uncharacterized protein; n=3; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 787 Score = 37.1 bits (82), Expect = 0.73 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 26 PPPPPPLPVEGASTSSSMPPPPPPRPAAPPQP 57 >UniRef50_A2DC30 Cluster: Formin Homology 2 Domain containing protein; n=1; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1128 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPPPP PPPPP G PPPP Sbjct: 607 PPPPPPPPPPGVAAAAPPPPPPPPGLAGLVPPPP 640 >UniRef50_Q7SF15 Cluster: Putative uncharacterized protein NCU07438.1; n=1; Neurospora crassa|Rep: Putative uncharacterized protein NCU07438.1 - Neurospora crassa Length = 636 Score = 37.1 bits (82), Expect = 0.73 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP PPP Sbjct: 509 PPPPPPPPPGGMGGVPPPPPPPPPGGMPPPP 539 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP PPPPP G PPPP Sbjct: 492 PPPPPPMPPMPAPSGGAPPPPPPPPPGGMGGVPPPP 527 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 506 GGAPPPPPPPPPGGMGG---VPPPPPPPPPGGMPPPP 539 >UniRef50_O43516 Cluster: WAS/WASL-interacting protein family member 1; n=34; Euteleostomi|Rep: WAS/WASL-interacting protein family member 1 - Homo sapiens (Human) Length = 503 Score = 37.1 bits (82), Expect = 0.73 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KPPPPPP + PPPPP PP P Sbjct: 263 KPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 >UniRef50_Q6P9Q4 Cluster: FH1/FH2 domain-containing protein 1; n=2; Mus musculus|Rep: FH1/FH2 domain-containing protein 1 - Mus musculus (Mouse) Length = 1197 Score = 37.1 bits (82), Expect = 0.73 Identities = 16/34 (47%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPPPP PPPPP G PPPP Sbjct: 603 PPPPPPLPPPATGSCPPPPPPPPPPIIGSCPPPP 636 >UniRef50_UPI00004D6F7D Cluster: formin-like 2; n=3; Euteleostomi|Rep: formin-like 2 - Xenopus tropicalis Length = 1054 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP G PP Sbjct: 542 PPPPPPPPPPPLPSAEPPVPPPPPPPPGAPP 572 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 543 PPPPPPPPPPLPSAEPPVPPPPPPPPGAPPLP 574 >UniRef50_Q8UZB6 Cluster: Replicase; n=5; Grapevine fleck virus|Rep: Replicase - Grapevine fleck virus Length = 1949 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 698 PPPPPPQPSPHPPLFPASIPSPPPRPSSPPPP 729 >UniRef50_Q77SA5 Cluster: Viral capsid associated protein; n=1; Ecotropis obliqua NPV|Rep: Viral capsid associated protein - Ecotropis obliqua NPV Length = 681 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 335 PPPPPPPPFSLPSQETSIVPPPPTMLMPPPPP 366 >UniRef50_Q3V4U6 Cluster: Putative uncharacterized protein; n=1; Acidianus two-tailed virus|Rep: Putative uncharacterized protein - Acidianus two-tailed virus Length = 1940 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PP PP PPPP Sbjct: 1876 PPPPPPPKTQTITTTTQITPPSPPPTPPPPPP 1907 >UniRef50_A3Q834 Cluster: Putative uncharacterized protein precursor; n=3; Mycobacterium|Rep: Putative uncharacterized protein precursor - Mycobacterium sp. (strain JLS) Length = 314 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 200 PPPPPPPVEAPPPPAVEAPLPPPPVEAAPPPP 231 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 190 PPPPPPPV--------EAPPPPPPPVEAPPPP 213 >UniRef50_Q9SRL3 Cluster: F9F8.15 protein; n=13; Magnoliophyta|Rep: F9F8.15 protein - Arabidopsis thaliana (Mouse-ear cress) Length = 451 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPPP PPP P PPPP Sbjct: 63 EPPPPPPTSPPPPSPPPPSPPPPSPPPPSPPPP 95 >UniRef50_Q42421 Cluster: Chitinase; n=1; Beta vulgaris subsp. vulgaris|Rep: Chitinase - Beta vulgaris subsp. vulgaris Length = 439 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP PPPP Sbjct: 98 PPPPPTPRPPPPRPPTPRPPPPPTPRPPPPP 128 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PP PP PPPP Sbjct: 116 PPPPPTPRPPPPPTPRPPPPSPPTPRPPPPP 146 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 + PPPP P + PPPPP P PP Sbjct: 123 RPPPPPTPRPPPPSPPTPRPPPPPPPSPPTPSPP 156 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPP P + PP PP PPPP Sbjct: 70 RPPPPRPPTPRPPPPTPRPPPPRPPTPRPPPPP 102 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 + PPP PP + PP PP PPPP Sbjct: 87 RPPPPRPPTPRPPPPPTPRPPPPRPPTPRPPPPP 120 >UniRef50_A2YML9 Cluster: Putative uncharacterized protein; n=2; Oryza sativa|Rep: Putative uncharacterized protein - Oryza sativa subsp. indica (Rice) Length = 205 Score = 36.7 bits (81), Expect = 0.96 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP P PP Sbjct: 88 PPPPPPPERAVPEAADTPPPPPPPTAPTPTPP 119 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP P P Sbjct: 87 PPPPPPPPERAVPEAADTPPPPPPPTAPTPTP 118 >UniRef50_Q8MQE6 Cluster: Wasp (Actin cytoskeleton modulator) homolog protein 1, isoform b; n=3; Caenorhabditis|Rep: Wasp (Actin cytoskeleton modulator) homolog protein 1, isoform b - Caenorhabditis elegans Length = 781 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP I PPPPP PPPP Sbjct: 611 PPPPPPPQSFGMAPISSAAPPPPP----PPPP 638 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 630 PPPPPPPPPMGLPAVGAGAPPPPP----PPPP 657 >UniRef50_Q54ER5 Cluster: Formin homology domain-containing protein; n=1; Dictyostelium discoideum AX4|Rep: Formin homology domain-containing protein - Dictyostelium discoideum AX4 Length = 2546 Score = 36.7 bits (81), Expect = 0.96 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP-----XXXGPPPP 512 PPPPPP K PPPPP GPPPP Sbjct: 1058 PPPPPPPPPPPGKSSGGGPPPPPPPPPKGGKGGPPPP 1094 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPP G PPP Sbjct: 1057 GPPPPPPPPPPPGKSSGGGPPPPPPPPPKGGKGGPPP 1093 >UniRef50_Q1HMI9 Cluster: Formin C; n=3; Trypanosoma cruzi|Rep: Formin C - Trypanosoma cruzi strain CL Brener Length = 937 Score = 36.7 bits (81), Expect = 0.96 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP KK PPPPP PP Sbjct: 474 PPPPPPPTSAGGKKGAPPPPPPPPSGAKKPP 504 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP PP Sbjct: 473 PPPPPPPPTSAGGKKGAPPPPPPPPSGAKKPP 504 >UniRef50_Q1HMI6 Cluster: Formin A; n=4; Trypanosoma cruzi|Rep: Formin A - Trypanosoma cruzi strain CL Brener Length = 1178 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 650 PPPPPPPPGAGAKSGLSPPPPPPPP---PPPP 678 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/37 (45%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG-----PPPP 512 PPPPPP K PPPPP G PPPP Sbjct: 521 PPPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 557 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP K PPPPP PPPP Sbjct: 538 PPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 573 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP K PPPPP PPPP Sbjct: 554 PPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 589 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP K PPPPP PPPP Sbjct: 570 PPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 605 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP K PPPPP PPPP Sbjct: 586 PPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 621 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP K PPPPP PPPP Sbjct: 602 PPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 637 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP K PPPPP PPPP Sbjct: 618 PPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLPPPP 653 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 668 PPPPPPPPPPPGAGAKSGLPPPPP----PPPP 695 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP-----XXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 634 PPPPPPPPGAGAKSGLPPPPPPPPGAGAKSGLSPPPP 670 >UniRef50_Q6C9I8 Cluster: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding; n=1; Yarrowia lipolytica|Rep: Similar to sp|P41832 Saccharomyces cerevisiae YNL271c BNI1 regulator of budding - Yarrowia lipolytica (Candida lipolytica) Length = 1851 Score = 36.7 bits (81), Expect = 0.96 Identities = 16/35 (45%), Positives = 17/35 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP + PPPPP PPPP F Sbjct: 1048 PPPPPPMFTGGPPPMFTGGPPPPP----PPPPPGF 1078 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP GPPPP Sbjct: 1067 PPPPPPPPPPGFT----GGPPPPGFTGGPPPP 1094 >UniRef50_UPI00015B4CAB Cluster: PREDICTED: hypothetical protein; n=1; Nasonia vitripennis|Rep: PREDICTED: hypothetical protein - Nasonia vitripennis Length = 972 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPP + PPPPP PPPP Sbjct: 750 RPPPPPTRPPTRPPQPPVTRPPPPPPTRPPPPP 782 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPP--PXXXGPPPP 512 +PPPPPP + PPPP P PPPP Sbjct: 527 RPPPPPPTRPPVTQTPYTRPPPPPTRPPTRPPPPP 561 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPP PP PP PPPP Sbjct: 492 RPPPPPTAPSTYLPPAPPTRPPQPPVTRPPPPP 524 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPP PP PP PPPP Sbjct: 556 RPPPPPTQPSTYLPPAPPTRPPQPPVTRPPPPP 588 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPP PP PP PPPP Sbjct: 670 RPPPPPTRPSTYLPPAPPTRPPKPPVTRPPPPP 702 >UniRef50_UPI0000F1F796 Cluster: PREDICTED: hypothetical protein; n=2; Danio rerio|Rep: PREDICTED: hypothetical protein - Danio rerio Length = 1493 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/35 (42%), Positives = 18/35 (51%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXP---PPPPXXXGPPPP 512 PPPPPP + + + P PPPP PPPP Sbjct: 828 PPPPPPFSPKTLQSLPQLPPGIPPPPPQAVPPPPP 862 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 402 GXXKKPP---PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PP PPPP + PPPPP PPPP Sbjct: 848 GIPPPPPQAVPPPPPQAVPPPPLQAVPPPPPPQAVPPPPP 887 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP + PPPPP PPPP Sbjct: 866 PPPPLQAVPPPPPPQAVPPPPPQAVPPPPP 895 >UniRef50_UPI0000DB6FAC Cluster: PREDICTED: similar to Protein cappuccino; n=1; Apis mellifera|Rep: PREDICTED: similar to Protein cappuccino - Apis mellifera Length = 1007 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 464 PPPPPPPPPPTQSSAAGGGPPPPPPPPPPPTP 495 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPP PPP Sbjct: 463 PPPPPPPPPPPTQSSAAGGGPPPPPPPPPPP 493 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/35 (48%), Positives = 17/35 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP I PPPPP PPPP F Sbjct: 483 PPPPPPPPPPPTPMI--GVPPPPP----PPPPSVF 511 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/37 (43%), Positives = 19/37 (51%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP ++ + PPPPP PPPP Sbjct: 498 GVPPPPPPPPPSVFAGGQQ-QQPPPPPPP----PPPP 529 >UniRef50_UPI0000D55F3A Cluster: PREDICTED: similar to CG14622-PC, isoform C; n=1; Tribolium castaneum|Rep: PREDICTED: similar to CG14622-PC, isoform C - Tribolium castaneum Length = 1127 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/34 (50%), Positives = 17/34 (50%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPPP PPPPP GPPPP Sbjct: 596 KSPPPPPP-----------LAPPPPPPAPGPPPP 618 >UniRef50_UPI000049858C Cluster: hypothetical protein 101.t00009; n=1; Entamoeba histolytica HM-1:IMSS|Rep: hypothetical protein 101.t00009 - Entamoeba histolytica HM-1:IMSS Length = 863 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 22 PPPPPPAGAPPPPSGGMPPPPPPPAGAPPPP 52 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 22 PPPPPPAGAPPPPSGGMPPPPPPPAGAPPPP 52 >UniRef50_Q4RDJ1 Cluster: Chromosome undetermined SCAF16309, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome undetermined SCAF16309, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 283 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP I PPPP G PPP Sbjct: 221 PPPPPPLPISPSNGISPPPPPPPMTGSGFPPP 252 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP ++ + PPPPP PPPP Sbjct: 250 PPPPPLNHSGSTGRLGRLPPPPPPPP--PPPP 279 >UniRef50_Q4A2U1 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 2873 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 216 PPPPPPPPPSPPPPSPPPPPPPSPPPPSPPPP 247 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 217 PPPPPPPPSPPPPSPPPPPPPSPPPPSPPPPP 248 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 218 PPPPPPPSPPPPSPPPPPPPSPPPPSPPPPPP 249 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 226 PPPPSPPPPPPPSPPPPSPPPPPPPSPPPPPP 257 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 227 PPPSPPPPPPPSPPPPSPPPPPPPSPPPPPPP 258 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 205 PPPPPPPPPLPPPPPPPPPPSPPPPSPPPPPP 236 >UniRef50_Q0ILB7 Cluster: ORF1629; n=1; Leucania separata nuclear polyhedrosis virus|Rep: ORF1629 - Leucania separata nuclear polyhedrosis virus (LsNPV) Length = 589 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP PPPP Sbjct: 252 PPPPPPPPMPVESGSPPPPPPPPPPPPPPPP 282 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +P PPPP + PPPPP PPPP Sbjct: 249 QPIPPPPPPPPMPVESGSPPPPPPPPPPPPPPP 281 >UniRef50_Q62CV6 Cluster: Hemagglutinin domain protein; n=8; Burkholderia|Rep: Hemagglutinin domain protein - Burkholderia mallei (Pseudomonas mallei) Length = 373 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 96 PPPPPPPPPPPPSPPPPSPPPPSPPPPSPPPP 127 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 101 PPPPPPPSPPPPSPPPPSPPPPSPPPPSPPPP 132 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 91 PPPPPPPPPPPPPPPPPSPPPPSPPPPSPPPP 122 >UniRef50_A3Q1Z8 Cluster: Molecular chaperone-like; n=4; Mycobacterium|Rep: Molecular chaperone-like - Mycobacterium sp. (strain JLS) Length = 568 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP PPPP Sbjct: 507 PPPPPAQEPPPPPPAEEPPPPPPAEEPPPPP 537 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 ++PPPPPP + PPPPP PP Sbjct: 513 QEPPPPPPAEEPPPPPPAEEPPPPPPTTQPPP 544 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPP PPPP Sbjct: 507 PPPPPAQEPPPPPPAEEPPPPPPAEEPPPPPP 538 >UniRef50_A2SK16 Cluster: Putative uncharacterized protein; n=1; Methylibium petroleiphilum PM1|Rep: Putative uncharacterized protein - Methylibium petroleiphilum (strain PM1) Length = 167 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP I PPPPP PPPP Sbjct: 28 PPPPPPAPAPVQAPI---QPPPPPAPPPPPPP 56 >UniRef50_A0GWT4 Cluster: Putative uncharacterized protein; n=2; Chloroflexus|Rep: Putative uncharacterized protein - Chloroflexus aggregans DSM 9485 Length = 600 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 516 PPPPPHAPAPPPPPHAPAPPPPPHAPAPPPP 546 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 497 PAPPPPPSHHAPPPPHAPAPPPPPHAPAPPPP 528 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PPPPP PPPP Sbjct: 508 PPPPHAPAPPPPPHAPAPPPPPHAPAPPPP 537 >UniRef50_Q6K8Z4 Cluster: Diaphanous homologue-like; n=6; Oryza sativa|Rep: Diaphanous homologue-like - Oryza sativa subsp. japonica (Rice) Length = 1391 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/38 (44%), Positives = 17/38 (44%), Gaps = 6/38 (15%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG------PPPP 512 PPPPPP K PPPPP G PPPP Sbjct: 770 PPPPPPPPMIPGMKTPPTPPPPPPAAPGQQAPAVPPPP 807 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G P PPPP ++ PPPPP PPPP Sbjct: 781 GMKTPPTPPPPPPAAPGQQAPAVPPPPPP----PPPP 813 >UniRef50_Q3HTL0 Cluster: Pherophorin-V1 protein precursor; n=1; Volvox carteri f. nagariensis|Rep: Pherophorin-V1 protein precursor - Volvox carteri f. nagariensis Length = 590 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPPP PP PP PPPP Sbjct: 203 KYPPPPPPPPPSPSPPPSPPPPPSPPPPPPPPPP 236 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 223 PPPSPPPPPPPPPPPSPPPPPPPPPPPSPPPP 254 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 229 PPPPPPPPPSPPPPPPPPPPPSPPPPPSPPPP 260 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 206 PPPPPPPPSPSPPPSPPPPPSPPPPPPPPPPP 237 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 208 PPPPPPSPSPPPSPPPPPSPPPPPPPPPPPSP 239 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 224 PPSPPPPPPPPPPPSPPPPPPPPPPPSPPPPP 255 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 232 PPPPPPSPPPPPPPPPPPSPPPPPSPPPPSPP 263 >UniRef50_Q2QUG5 Cluster: Retrotransposon protein, putative, unclassified, expressed; n=1; Oryza sativa (japonica cultivar-group)|Rep: Retrotransposon protein, putative, unclassified, expressed - Oryza sativa subsp. japonica (Rice) Length = 895 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 90 PPPQPPHLATPGASSSSSPPPPPPPPPPPPPP 121 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 89 PPPPQPPHLATPGASSSSSPPPPPPPPPPPPP 120 >UniRef50_Q0D4Y8 Cluster: Os07g0596300 protein; n=7; Eukaryota|Rep: Os07g0596300 protein - Oryza sativa subsp. japonica (Rice) Length = 754 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 60 PPPPPPPPPLKPSSGAPCPPPPPPPPPPPPP 90 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 60 PPPPPPPPPLKPSSGAPCPPPPPPPPPPPPP 90 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 6 PPPPPPPLMSFGAQTRTFVPPPPPP---PPPP 34 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP + PPPP GPPPP Sbjct: 177 PSPPPPPPPPGARPGPPPPPPPPGARPGPPPP 208 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/37 (40%), Positives = 18/37 (48%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G + PPPPP ++ PPPPP PPPP Sbjct: 251 GAGGRAPPPPPAPGG---RLGGPPPPPPPGGRAPPPP 284 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 156 PPPPPP--PPITRSGAPPSPPPPPSPPPPPPP 185 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPX----XXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 84 PPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPPP 119 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP----XXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 83 PPPPPPPPSAPSSRAFSSAPPPPPPPPLLRSVPPPP 118 >UniRef50_A5BPY4 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 341 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP K PPPPP PPP Sbjct: 19 GAAPSPPPPPPLPMMPLK--GSVPPPPPPKNGAAPPP 53 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPP P G PP Sbjct: 52 PPPPPPLPMMPLKGSVPAPPPPVPLKNGAAPP 83 >UniRef50_Q585V1 Cluster: Putative uncharacterized protein; n=1; Trypanosoma brucei|Rep: Putative uncharacterized protein - Trypanosoma brucei Length = 713 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/33 (45%), Positives = 15/33 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXG 500 G K PPPPPP K PPPPP G Sbjct: 275 GKLKAPPPPPPPFASIAGKTRAPLPPPPPAPTG 307 >UniRef50_A2DLA9 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 461 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP PP P Sbjct: 303 GGAPPPPPPPPPAAAGGAGVPPPPPPPPPPANLPPLP 339 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP PPPPP G PPPP Sbjct: 291 PPPPPPPPGAPGGGAPPPPPPPPPAAAGGAGVPPPP 326 >UniRef50_A0CZ14 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 417 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/33 (45%), Positives = 17/33 (51%), Gaps = 1/33 (3%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPP-PXXXGPPPP 512 PPPPPP ++ PPPP P PPPP Sbjct: 329 PPPPPPPPPIPGQQNPPPPPPPPLPGQQAPPPP 361 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG---PPPP 512 PPPPPP PPPPP G PPPP Sbjct: 313 PPPPPPPLPNSQAPPPPPPPPPPPPIPGQQNPPPP 347 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 290 PPPPPPPPPLPNSTSNVTAPPPPPPP--PPPP 319 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 309 PPPPPPPPPPPLPNSQAPPPPPPPP---PPPP 337 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPP PPP Sbjct: 289 PPPPPPPPPPLPNSTSNVTAPPPPPPPPPPP 319 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/34 (41%), Positives = 17/34 (50%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 ++ PPPPP + PPPPP PPPP Sbjct: 355 QQAPPPPPPLPGGAR---PPPPPPPPFGNAPPPP 385 Score = 33.9 bits (74), Expect = 6.8 Identities = 18/38 (47%), Positives = 18/38 (47%), Gaps = 1/38 (2%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPP-PPXXXGPPPP 512 G PPPPPP KI PPP P GPPPP Sbjct: 379 GNAPPPPPPPP-----GSKIPGPPPPPGGPRPPGPPPP 411 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 G PPPPPP + PPPPP G PPPP Sbjct: 340 GQQNPPPPPPPPLPG-----QQAPPPPPPLPGGARPPPP 373 Score = 33.5 bits (73), Expect = 8.9 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPX--XXGPPPP 512 G + PPPPPP PPPPP GPPPP Sbjct: 366 GGARPPPPPPPPFGNAPPP-----PPPPPGSKIPGPPPP 399 >UniRef50_A0CYS3 Cluster: Chromosome undetermined scaffold_31, whole genome shotgun sequence; n=1; Paramecium tetraurelia|Rep: Chromosome undetermined scaffold_31, whole genome shotgun sequence - Paramecium tetraurelia Length = 1083 Score = 36.3 bits (80), Expect = 1.3 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP-----XXXGPPPP 512 PPPPPP ++ PPPPP GPPPP Sbjct: 585 PPPPPPPPPPPVQQTGTSLPPPPPPPPIQTTGGPPPP 621 >UniRef50_Q504V9 Cluster: ZNF341 protein; n=10; Euteleostomi|Rep: ZNF341 protein - Homo sapiens (Human) Length = 795 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 +PPPPPP PPPPP GPP Sbjct: 118 QPPPPPPPPPPLPPPPPPQPPPPPPQSLGPP 148 >UniRef50_Q17R98 Cluster: LOC152485 protein; n=42; Euteleostomi|Rep: LOC152485 protein - Homo sapiens (Human) Length = 1081 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP KK K PPPPP PPPP Sbjct: 314 PLPPPPSE----KKPEKVTPPPPPPPPPPPPP 341 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 P PPP +K+ PPPPP PPP Sbjct: 314 PLPPPPSEKKPEKVTPPPPPPPPPPPPPPP 343 >UniRef50_A4QSC9 Cluster: Predicted protein; n=2; Fungi/Metazoa group|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 309 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 248 PPPPPP---PPSSSLPPPPPPPPPSSTRPPPP 276 >UniRef50_A3GHC4 Cluster: Predicted protein; n=1; Pichia stipitis|Rep: Predicted protein - Pichia stipitis (Yeast) Length = 392 Score = 36.3 bits (80), Expect = 1.3 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPP PPPPP PPPP Sbjct: 324 GIKPPAPPPPPATGFPPPPPPSVKPPPPPSAAKPPPP 360 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 339 PPPPPPSVKPPPPPSAAKPPPPPSEVKVPPPP 370 >UniRef50_Q9BYN7 Cluster: Zinc finger protein 341; n=86; Eumetazoa|Rep: Zinc finger protein 341 - Homo sapiens (Human) Length = 854 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 +PPPPPP PPPPP GPP Sbjct: 177 QPPPPPPPPPPLPPPPPPQPPPPPPQSLGPP 207 >UniRef50_Q68DA7 Cluster: Formin-1; n=14; Theria|Rep: Formin-1 - Homo sapiens (Human) Length = 1419 Score = 36.3 bits (80), Expect = 1.3 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXP---PPPPXXXGPPPPXXFF 524 PPPPPP P PPPP PPPP FF Sbjct: 923 PPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPPGLFF 961 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 906 PPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPP 937 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP P P Sbjct: 900 GPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAP 936 >UniRef50_Q6BSP4 Cluster: Branchpoint-bridging protein; n=2; Saccharomycetaceae|Rep: Branchpoint-bridging protein - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 518 Score = 36.3 bits (80), Expect = 1.3 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 446 PPPPPSSDIAPPPPSSDRAPPPPPSGIAPPPP 477 >UniRef50_UPI0001552F36 Cluster: PREDICTED: similar to SH3 domain binding protein; n=2; Mus musculus|Rep: PREDICTED: similar to SH3 domain binding protein - Mus musculus Length = 455 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 4 PPPPPPPPPPPPPPPPPLGAPPPPPLGAPPPP 35 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 7 PPPPPPPPPPPPPPL--GAPPPPPLGAPPPPP 36 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 6 PPPPPPPPPPPPPPPLGAPPPPPLGAPPPPPP 37 >UniRef50_Q90WR5 Cluster: Keratin alpha; n=1; Lampetra fluviatilis|Rep: Keratin alpha - Lampetra fluviatilis (River lamprey) Length = 629 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/33 (51%), Positives = 17/33 (51%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGGF 413 GGGG GGGGG F GGGGGGF Sbjct: 533 GGGGGGGCGGGGGGGGGSGFGLGLGLGGGGGGF 565 >UniRef50_Q4RSI9 Cluster: Chromosome 13 SCAF15000, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 13 SCAF15000, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 307 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 174 PPPLPPPPFPLFPLFPPPPPPPPPPPFSPPPP 205 >UniRef50_A1L2E9 Cluster: Putative uncharacterized protein; n=3; Danio rerio|Rep: Putative uncharacterized protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 428 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP G PPP Sbjct: 335 PPPPPPRPGNMG--VPPPPPPPPPGNMGVPPP 364 Score = 34.3 bits (75), Expect = 5.1 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPP Sbjct: 376 PPPPPPPPGYTGSSLPPPAPPPPQNASMAPPP 407 >UniRef50_Q9Q5L3 Cluster: EBNA-2; n=2; Cercopithecine herpesvirus 15|Rep: EBNA-2 - Cercopithecine herpesvirus 15 (Rhesus lymphocryptovirus) Length = 605 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP PPPP Sbjct: 63 GAPPPPPPPPPLPPPPPPPL----PPPPPPPVQPPPP 95 >UniRef50_Q9A2R2 Cluster: OmpA family protein; n=5; Caulobacter|Rep: OmpA family protein - Caulobacter crescentus (Caulobacter vibrioides) Length = 449 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPPPP PPPP F Sbjct: 306 PPPPPPPPPPPPPPPPPPPPPPPPPP--PPPPPAF 338 >UniRef50_Q2N5D9 Cluster: Autotransporter; n=1; Erythrobacter litoralis HTCC2594|Rep: Autotransporter - Erythrobacter litoralis (strain HTCC2594) Length = 1819 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP P PP Sbjct: 1406 GTAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPTPP 1442 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 1417 PPPPPPPPPPPPPPPPPPPPPPPTPPPAPPPP 1448 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 1413 PPPPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 1412 PPPPPPPPPPPPPPPPPPPPPPPPPPPPTPPP 1443 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 1414 PPPPPPPPPPPPPPPPPPPPPPPPPPTPPPAP 1445 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 1415 PPPPPPPPPPPPPPPPPPPPPPPPPTPPPAPP 1446 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 1416 PPPPPPPPPPPPPPPPPPPPPPPPTPPPAPPP 1447 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 1418 PPPPPPPPPPPPPPPPPPPPPPTPPPAPPPPP 1449 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 1419 PPPPPPPPPPPPPPPPPPPPPTPPPAPPPPPP 1450 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 1420 PPPPPPPPPPPPPPPPPPPPTPPPAPPPPPPP 1451 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 1422 PPPPPPPPPPPPPPPPPPTPPPAPPPPPPPPP 1453 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 1423 PPPPPPPPPPPPPPPPPTPPPAPPPPPPPPPP 1454 >UniRef50_Q10BX5 Cluster: Expressed protein; n=3; Oryza sativa|Rep: Expressed protein - Oryza sativa subsp. japonica (Rice) Length = 357 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KKPPPPP K PPPP PP P Sbjct: 176 KKPPPPPEAHHRPTKSYTGHPPPPPLEKDAPPQP 209 >UniRef50_Q0JA38 Cluster: Os04g0617200 protein; n=2; Oryza sativa (japonica cultivar-group)|Rep: Os04g0617200 protein - Oryza sativa subsp. japonica (Rice) Length = 149 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P + PPPPP PPPP Sbjct: 18 PPPPLPPPPHPSPPLPLPTPPPPPPSPPPPPP 49 >UniRef50_Q010M7 Cluster: Predicted membrane protein; n=3; Eukaryota|Rep: Predicted membrane protein - Ostreococcus tauri Length = 1449 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/37 (37%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G ++ PPP P PPPPP PPPP Sbjct: 781 GQARQSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPP 817 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 + PPP PP PPPPP PPPP Sbjct: 785 QSPPPSPPPPLPPSPPPPPSPPPPPPPPSPPPPP 818 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 805 PPPPPPPPSPPPPPNPPTPPSPPPPPSPPPPP 836 >UniRef50_A7QQ26 Cluster: Chromosome chr2 scaffold_140, whole genome shotgun sequence; n=1; Vitis vinifera|Rep: Chromosome chr2 scaffold_140, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 1163 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 632 PPPPPPPDFSSSSSNKPTLPPPPPPPPAPPLP 663 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 2/36 (5%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXP--PPPPXXXGPPPP 512 K P PPPP + P PP P GPPPP Sbjct: 575 KAPSPPPPPPPPPLPNVSNGNPLMPPTPASRGPPPP 610 >UniRef50_A5BR16 Cluster: Putative uncharacterized protein; n=1; Vitis vinifera|Rep: Putative uncharacterized protein - Vitis vinifera (Grape) Length = 196 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 17 PPPPPPSPSPPPPPSPSPSPPPPPSPSPPPSP 48 >UniRef50_Q61TJ4 Cluster: Putative uncharacterized protein CBG05727; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG05727 - Caenorhabditis briggsae Length = 288 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/37 (40%), Positives = 19/37 (51%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIX-----KXXPPPPPXXXGPPPP 512 PPPPPP +++ + PPPPP G PPP Sbjct: 127 PPPPPPPPSDEPQEVVAGGASRRPPPPPPRGTGTPPP 163 >UniRef50_Q5CS67 Cluster: Signal peptide containing large protein with proline stretches; n=2; Cryptosporidium|Rep: Signal peptide containing large protein with proline stretches - Cryptosporidium parvum Iowa II Length = 1884 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/37 (40%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G K+ PP PP PPPPP PPPP Sbjct: 1527 GNGKRTPPHPPPSSGSSAPPPPPPPPPPPPPPPPPPP 1563 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PP PPP PPPPP PPPP + Sbjct: 1168 PPHPPPSSGSFTPPPPPPPPPPPPPPPPPPPPPSY 1202 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G + PP PP PPPPP PPPP Sbjct: 1159 GPFGQRPPSPPHPPPSSGSFTPPPPPPPPPPPPPPPP 1195 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/41 (39%), Positives = 17/41 (41%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 G PPPPPP PPPPP PPP F+ Sbjct: 1541 GSSAPPPPPPPPPPPPPP------PPPPPSPPPSPPPSPFY 1575 >UniRef50_Q5C3I4 Cluster: SJCHGC03138 protein; n=2; Schistosoma japonicum|Rep: SJCHGC03138 protein - Schistosoma japonicum (Blood fluke) Length = 156 Score = 35.9 bits (79), Expect = 1.7 Identities = 17/32 (53%), Positives = 18/32 (56%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K+ PPPPP GPPPP Sbjct: 34 PPPPPPFFFNKKKR-----PPPPP--GGPPPP 58 >UniRef50_Q17G68 Cluster: Formin 1,2/cappuccino; n=2; Culicidae|Rep: Formin 1,2/cappuccino - Aedes aegypti (Yellowfever mosquito) Length = 891 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PP PP PPPP Sbjct: 337 PPPPPPISSVSIPPSTSGGPPAPPLPPPPPPP 368 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 311 PPPPPPMFKTAVAPPGPPPLPPPPPPPPPPPP 342 >UniRef50_A2FMX2 Cluster: DnaK protein; n=2; Trichomonas vaginalis G3|Rep: DnaK protein - Trichomonas vaginalis G3 Length = 915 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP PPPP Sbjct: 878 PPPPPHDIPPPPPRPEDIPPPPPHEDVPPPP 908 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP PPPP Sbjct: 859 PPPPPHDDIPPPPPRPEDIPPPPPHDIPPPPP 890 >UniRef50_A2DM28 Cluster: Diaphanous, putative; n=1; Trichomonas vaginalis G3|Rep: Diaphanous, putative - Trichomonas vaginalis G3 Length = 620 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 108 PPPPPARPPPPPPTAPPATPPPPPPNHPPPPP 139 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 127 PPPPPPNHPPPPPPKSNDIPPPPPAAIPPPAP 158 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 2/35 (5%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPP--PXXXGPPPP 512 +PPPPPP + PPPP P PPPP Sbjct: 97 RPPPPPPKSDAPPPPPARPPPPPPTAPPATPPPPP 131 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 529 GAGAPPPPPPPAGGAPPPP-----PPPPPKGGAPPPP 560 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 544 PPPPPPPPPKGG-----APPPPPPPARAPPPP 570 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 522 PPPPPPPGAGAPP------PPPPPAGGAPPPP 547 >UniRef50_A2DI20 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 460 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 342 PPPPAPAAPPPPPAPAAPPPPPPPSVPAPPPP 373 >UniRef50_Q5T8W7 Cluster: Espin; n=51; Euteleostomi|Rep: Espin - Homo sapiens (Human) Length = 854 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 430 PPPPPPSFPPPPPPPGTQLPPPPPGYPAPKPP 461 >UniRef50_Q6BNL1 Cluster: Similar to sp|P32521 Saccharomyces cerevisiae PAN1 protein; n=2; cellular organisms|Rep: Similar to sp|P32521 Saccharomyces cerevisiae PAN1 protein - Debaryomyces hansenii (Yeast) (Torulaspora hansenii) Length = 1449 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 1349 PPPPPPMDTPPIPSSSAPPPPPPPPGAAPPLP 1380 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/33 (45%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 417 PPPPPPXXXXXXKKI-XKXXPPPPPXXXGPPPP 512 PPPPPP I PPPPP G PP Sbjct: 1346 PPPPPPPPPMDTPPIPSSSAPPPPPPPPGAAPP 1378 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 1327 PPPPPPPSNIPPLPNTSAPPPPPP----PPPP 1354 >UniRef50_Q5AL52 Cluster: Putative uncharacterized protein BNI1; n=1; Candida albicans|Rep: Putative uncharacterized protein BNI1 - Candida albicans (Yeast) Length = 1732 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPPPP PPPP F Sbjct: 1059 PPPPPPLPPILGGNNSSAAPPPPPP---PPPPPAF 1090 >UniRef50_Q2H4B1 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 592 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PP P Sbjct: 210 PPPPPPPPSNPPGGNLRAPPPPPPPPAAPPRP 241 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/40 (37%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPP---XXXGPPPP 512 G + PPPPPP + + + P PPP GP PP Sbjct: 223 GNLRAPPPPPPPPAAPPRPVPEAAPAPPPPPAPKRGPAPP 262 >UniRef50_A5DSH8 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 1940 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P + PPPPP PPPP Sbjct: 1244 PPPPLPPLHYGSQNSLAPGPPPPPPPPPPPPP 1275 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 1242 PPPPPPLPPLHYGSQNSLAPGPPPPPPPPPPP 1273 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP I PPPPP PPP Sbjct: 1269 PPPPPPPGLSVGSNIAGPPPPPPP----PPP 1295 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 1262 GPPPPPPPPPPPPPGLSVGSNIAGPPPPPP---PPPP 1295 >UniRef50_A5DD96 Cluster: Putative uncharacterized protein; n=1; Pichia guilliermondii|Rep: Putative uncharacterized protein - Pichia guilliermondii (Yeast) (Candida guilliermondii) Length = 1564 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/34 (47%), Positives = 17/34 (50%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPPP + PPPPP PPPP Sbjct: 853 KAPPPPPPLPPLLIGNGAQPPPPPPPP---PPPP 883 >UniRef50_A4R0U8 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 198 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 62 PPPPPPPVVEVPPPCIEVPPPPPPPP--PPPP 91 Score = 35.9 bits (79), Expect = 1.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP I PPPPP P PP Sbjct: 63 PPPPPPVVEVPPPCIEVPPPPPPPPPPPPCPP 94 >UniRef50_Q03211 Cluster: Pistil-specific extensin-like protein precursor; n=2; Nicotiana|Rep: Pistil-specific extensin-like protein precursor - Nicotiana tabacum (Common tobacco) Length = 426 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP K PPPPP P P Sbjct: 179 PPPPPPPVKAPSPSPAKQPPPPPPPVKAPSP 209 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP P P Sbjct: 180 PPPPPPVKAPSPSPAKQPPPPPPPVKAPSPSP 211 >UniRef50_Q0GNC1 Cluster: Inverted formin-2; n=13; Euteleostomi|Rep: Inverted formin-2 - Mus musculus (Mouse) Length = 1273 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/36 (44%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPPPP + PPPPP G PPPP Sbjct: 508 PPPPPPLPSLPDSHKTQPPPPPPPPLPGMCPVPPPP 543 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 472 PPPPPPPLPPPLPGSGTISPPPPP----PPPP 499 >UniRef50_O94532 Cluster: Formin-3; n=1; Schizosaccharomyces pombe|Rep: Formin-3 - Schizosaccharomyces pombe (Fission yeast) Length = 1461 Score = 35.9 bits (79), Expect = 1.7 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 1/35 (2%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXX-PPPPPXXXGPPPP 512 K PPPPPP PPP P GPPPP Sbjct: 730 KSPPPPPPAVIVPTPAPAPIPVPPPAPIMGGPPPP 764 >UniRef50_Q24120 Cluster: Protein cappuccino; n=6; Drosophila melanogaster|Rep: Protein cappuccino - Drosophila melanogaster (Fruit fly) Length = 1059 Score = 35.9 bits (79), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 505 PPPPPPPPPLANYGAPPPPPPPPPGSGSAPPP 536 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/35 (42%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP---XXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 503 PPPPPPPPPPPLANYGAPPPPPPPPPGSGSAPPPP 537 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 487 PPPPPPPLHAFV-----APPPPPPPPPPPPPP 513 >UniRef50_O60885 Cluster: Bromodomain-containing protein 4; n=70; Coelomata|Rep: Bromodomain-containing protein 4 - Homo sapiens (Human) Length = 1362 Score = 35.9 bits (79), Expect = 1.7 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PP PPP +++ + PPPPP PPP Sbjct: 956 PPLPPPPHPSVQQQLQQQPPPPPPPQPQPPP 986 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP ++ + PPPPP PPP Sbjct: 955 PPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPP 986 >UniRef50_UPI000023DB29 Cluster: hypothetical protein FG02238.1; n=1; Gibberella zeae PH-1|Rep: hypothetical protein FG02238.1 - Gibberella zeae PH-1 Length = 1043 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP GPPP Sbjct: 350 PPPPPPPQAPQGH--VSSAPPPPPPPPGPPP 378 >UniRef50_Q4SUB2 Cluster: Chromosome 3 SCAF13974, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 3 SCAF13974, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 692 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 115 PPPPPPPPPPPLPSFTLSPPPPPPPP--PPPP 144 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 116 PPPPPPPPPPLPSFTLSPPPPPPPPPPPPLPP 147 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 118 PPPPPPPPLPSFTLSPPPPPPPPPPPPLPPSP 149 >UniRef50_Q4RQM1 Cluster: Chromosome 2 SCAF15004, whole genome shotgun sequence; n=1; Tetraodon nigroviridis|Rep: Chromosome 2 SCAF15004, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1278 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP +I PPPPP P P Sbjct: 683 PPPPPPLPPGLASEISAPLPPPPPPLAPPLP 713 >UniRef50_A4QN64 Cluster: Zgc:162320 protein; n=8; Danio rerio|Rep: Zgc:162320 protein - Danio rerio (Zebrafish) (Brachydanio rerio) Length = 412 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PP PP GPPPP Sbjct: 166 PPPPPSAPPPAPASGPPPPPGPPPAPGPPPP 196 >UniRef50_A3KGD0 Cluster: Novel protein possible orthologue to human chromosome X open reading frame 45; n=1; Mus musculus|Rep: Novel protein possible orthologue to human chromosome X open reading frame 45 - Mus musculus (Mouse) Length = 782 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPP PPPPP PPPP + Sbjct: 541 PPPPPATLEAGDASGFPLPPPPPPPPPPPPPYSY 574 >UniRef50_Q8YQB7 Cluster: All3916 protein; n=2; Nostocaceae|Rep: All3916 protein - Anabaena sp. (strain PCC 7120) Length = 383 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 353 PPPPPPDPPPPPDPPPPDRPPPPPPEPPPPP 383 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 327 PPDPPPPDPPPPDPPPPPDPPPPPDPPPPPPP 358 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 333 PDPPPPDPPPPPDPPPPPDPPPPPPPDPPPPP 364 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 352 PPPPPPPDPPPPPDPPPPDRPPPPPPEPPPPP 383 >UniRef50_Q8PPF4 Cluster: Putative uncharacterized protein XAC0732; n=2; Xanthomonas|Rep: Putative uncharacterized protein XAC0732 - Xanthomonas axonopodis pv. citri Length = 266 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/40 (42%), Positives = 17/40 (42%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 G PPPPPP PPPPP PPPP F Sbjct: 229 GFAPPPPPPPPPPP------PPPPPPPPPPPPPPPPPPPF 262 >UniRef50_Q2IHA5 Cluster: Putative uncharacterized protein; n=1; Anaeromyxobacter dehalogenans 2CP-C|Rep: Putative uncharacterized protein - Anaeromyxobacter dehalogenans (strain 2CP-C) Length = 359 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPP---PXXXGPPPP 512 PPPPPP PPPP P GPPPP Sbjct: 88 PPPPPPPPGGYGAPPPAWGPPPPSGAPGGWGPPPP 122 >UniRef50_Q0M671 Cluster: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region; n=1; Caulobacter sp. K31|Rep: Glycoside hydrolase, family 16:Hemolysin-type calcium-binding region - Caulobacter sp. K31 Length = 608 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 468 PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 498 >UniRef50_Q07PB7 Cluster: Peptidase C14, caspase catalytic subunit p20 precursor; n=3; Bradyrhizobiaceae|Rep: Peptidase C14, caspase catalytic subunit p20 precursor - Rhodopseudomonas palustris (strain BisA53) Length = 1067 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + + PPPPP PPP Sbjct: 944 PPPPPAAHPAPPPPVVRPAPPPPPVVRQAPPP 975 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKK--IXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 983 PPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPP 1016 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKK--IXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 1004 PPPPPPVVRPPPPPPPAARPAPPPPPPVVRPPPP 1037 Score = 33.9 bits (74), Expect = 6.8 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPPP PPPPP PPPP Sbjct: 1012 RPPPPPPPAARPAP------PPPPPVVRPPPPP 1038 >UniRef50_A1G720 Cluster: Tetratricopeptide TPR_2; n=2; Salinispora|Rep: Tetratricopeptide TPR_2 - Salinispora arenicola CNS205 Length = 1143 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/36 (38%), Positives = 16/36 (44%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 G PPPP P + + PPP P GPPP Sbjct: 360 GTTGTPPPPRPPQGHPGDDVPRRPPPPVPGMAGPPP 395 >UniRef50_Q9LUI1 Cluster: Extensin protein-like; n=10; Magnoliophyta|Rep: Extensin protein-like - Arabidopsis thaliana (Mouse-ear cress) Length = 470 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PP PPP PPPPP PPPP + Sbjct: 376 PPSPPPPPPPPPPPPPPPPPPPPPPPPPPPPPYVY 410 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 399 PPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPP 430 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 384 PPPPPPPPPPPPPPPPPPPPPPPPYVYPSPPP 415 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 385 PPPPPPPPPPPPPPPPPPPPPPPYVYPSPPPP 416 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PP PP PPPP + Sbjct: 398 PPPPPPPPPPYVYPSPPPPPPSPPPYVYPPPPPPY 432 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 383 PPPPPPPPPPPPPPPPPPPPPPPPPYVYPSPP 414 >UniRef50_Q9FLQ6 Cluster: Similarity to unknown protein; n=2; Arabidopsis thaliana|Rep: Similarity to unknown protein - Arabidopsis thaliana (Mouse-ear cress) Length = 832 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/40 (40%), Positives = 18/40 (45%), Gaps = 3/40 (7%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXG---PPPP 512 G PPPPPP ++ PPPPP PPPP Sbjct: 19 GRVPLPPPPPPPPPPMRRRAPLPPPPPPPMRRRAPLPPPP 58 >UniRef50_Q9C946 Cluster: Putative uncharacterized protein T7P1.21; n=1; Arabidopsis thaliana|Rep: Putative uncharacterized protein T7P1.21 - Arabidopsis thaliana (Mouse-ear cress) Length = 907 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 508 PPPPPPPPLPTTIAAPPPPPPPPRAAVAPPPP 539 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPP Sbjct: 523 PPPPPP---PPRAAVAPPPPPPPPGTAAAPPP 551 >UniRef50_Q9NGX2 Cluster: Diaphanous protein; n=3; Entamoeba histolytica|Rep: Diaphanous protein - Entamoeba histolytica Length = 1209 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/38 (42%), Positives = 17/38 (44%), Gaps = 1/38 (2%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKI-XKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 605 GASSVPPPPPPPGMPGMPGMPGMPPPPPPPGMPGMPPP 642 >UniRef50_Q55FU3 Cluster: Putative uncharacterized protein; n=1; Dictyostelium discoideum AX4|Rep: Putative uncharacterized protein - Dictyostelium discoideum AX4 Length = 354 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP I PPPPP G PPP Sbjct: 94 PPPPTAAATTSSNIPPPPPPPPPPMTGVPPP 124 >UniRef50_Q54B83 Cluster: Wiscott-Aldrich syndrome protein; n=2; Dictyostelium discoideum|Rep: Wiscott-Aldrich syndrome protein - Dictyostelium discoideum AX4 Length = 399 Score = 35.5 bits (78), Expect = 2.2 Identities = 17/41 (41%), Positives = 17/41 (41%), Gaps = 4/41 (9%) Frame = +3 Query: 402 GXXKKPPPPP----PXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPP P PPPPP GPPPP Sbjct: 270 GKSAPPPPPPSHKTPAAPPSGGGAPPPPPPPPPPSSGPPPP 310 >UniRef50_Q4DD93 Cluster: Putative uncharacterized protein; n=3; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 1447 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 244 PPPPPPPPQGAFYLAPHGMPPPPPPPPPPPP 274 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 245 PPPPPPPQGAFYLAPHGMPPPPPPPP--PPPP 274 >UniRef50_Q4DD51 Cluster: Putative uncharacterized protein; n=2; Trypanosoma cruzi|Rep: Putative uncharacterized protein - Trypanosoma cruzi Length = 603 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP---XXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 391 PPPPPPPPPPAGKAPPPPIPPPPPGFKSMKAPPPP 425 Score = 33.9 bits (74), Expect = 6.8 Identities = 17/34 (50%), Positives = 18/34 (52%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPP P K + K PPPPP PPPP Sbjct: 403 KAPPPPIPPPPPGFKSM-KAPPPPPP----PPPP 431 >UniRef50_Q1HMI7 Cluster: Formin B; n=4; Trypanosoma cruzi|Rep: Formin B - Trypanosoma cruzi strain CL Brener Length = 968 Score = 35.5 bits (78), Expect = 2.2 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPPP Sbjct: 473 PPPPPPPGKNAPPPPPPPPPPPPHGKKAPPPP 504 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPP Sbjct: 472 PPPPPPPPGKNAPPPPPPPPPPPPHGKKAPPP 503 >UniRef50_A7SLQ1 Cluster: Predicted protein; n=2; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1027 Score = 35.5 bits (78), Expect = 2.2 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP G PPP Sbjct: 416 PPPPPPPPGG----VPPPPPPPPPGMGGAPPP 443 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPP GPPPP Sbjct: 424 GGVPPPPPPPPPGMGGAP--PPPPPPPPGMGGGPPPP 458 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPP GPPPP Sbjct: 438 GGAPPPPPPPPPGMGGGP--PPPPPPPPGPGGGPPPP 472 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP GPP P Sbjct: 452 GGGPPPPPPPPPGPGGGPP-----PPPPPPGGGPPGP 483 >UniRef50_A5DWT6 Cluster: Putative uncharacterized protein; n=1; Lodderomyces elongisporus NRRL YB-4239|Rep: Putative uncharacterized protein - Lodderomyces elongisporus (Yeast) (Saccharomyces elongisporus) Length = 1156 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/34 (47%), Positives = 18/34 (52%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 ++PPPPPP K K P PPP PPPP Sbjct: 57 QQPPPPPPLPELLPPKPTK--PLPPPSSSPPPPP 88 >UniRef50_Q05858 Cluster: Formin; n=26; Euteleostomi|Rep: Formin - Gallus gallus (Chicken) Length = 1213 Score = 35.5 bits (78), Expect = 2.2 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGP 503 PPPPPP + PPPPP GP Sbjct: 663 PPPPPPPPPFSDSSLPGLVPPPPPLPTGP 691 >UniRef50_Q6C187 Cluster: Branchpoint-bridging protein; n=1; Yarrowia lipolytica|Rep: Branchpoint-bridging protein - Yarrowia lipolytica (Candida lipolytica) Length = 605 Score = 35.5 bits (78), Expect = 2.2 Identities = 16/37 (43%), Positives = 18/37 (48%), Gaps = 2/37 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXK--KIXKXXPPPPPXXXGPP 506 G K PPPPPP + + PPPPP GPP Sbjct: 568 GLSKVPPPPPPPGVPGMDGDQPIRHPPPPPPGVIGPP 604 >UniRef50_UPI0000E47C9C Cluster: PREDICTED: similar to PX serine/threonine kinase; n=2; Strongylocentrotus purpuratus|Rep: PREDICTED: similar to PX serine/threonine kinase - Strongylocentrotus purpuratus Length = 710 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G P PPPP + PPPP GP PP Sbjct: 636 GNGAVPTPPPPSTPAQPPPVPSAPAPPPPPSQGPAPP 672 >UniRef50_Q5ZLQ1 Cluster: Putative uncharacterized protein; n=2; Gallus gallus|Rep: Putative uncharacterized protein - Gallus gallus (Chicken) Length = 1266 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/35 (45%), Positives = 16/35 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPPPP G PPP F Sbjct: 692 PPPPPPPPVVPG---CPPPPPPPPMVPGCPPPPGF 723 >UniRef50_Q4RR29 Cluster: Chromosome 14 SCAF15003, whole genome shotgun sequence; n=2; Tetraodontidae|Rep: Chromosome 14 SCAF15003, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1140 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP GPPPP Sbjct: 557 PPPPPLPGA----MMPPPPPPPPPPGGPPPP 583 >UniRef50_Q9YMX1 Cluster: Essential structural protein pp78-81; n=2; Nucleopolyhedrovirus|Rep: Essential structural protein pp78-81 - Lymantria dispar multicapsid nuclear polyhedrosis virus (LdMNPV) Length = 555 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP +K PPPPP PPP Sbjct: 250 PPPPPPPPEPLQQKSSAVPPPPPPPL--PPP 278 Score = 34.7 bits (76), Expect = 3.9 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 PPPPPP ++ PPPPP PP Sbjct: 249 PPPPPPPPPEPLQQKSSAVPPPPPPPLPPP 278 >UniRef50_Q4A373 Cluster: Putative lectin protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative lectin protein precursor - Emiliania huxleyi virus 86 Length = 1994 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G KPP PPP P PPP PPPP Sbjct: 196 GVCSKPPSPPPPPPSPFPPSPPPSPAPPPPSPLPPPP 232 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 1699 PPSPPPPASPPLLPPAPPSPPPPPDPAPPPPP 1730 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 499 PPPPPPSPPPSPFLPPPSLPPPPPP--SPPPP 528 >UniRef50_Q2W246 Cluster: RTX toxins and related Ca2+-binding protein; n=1; Magnetospirillum magneticum AMB-1|Rep: RTX toxins and related Ca2+-binding protein - Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) Length = 2065 Score = 35.1 bits (77), Expect = 2.9 Identities = 13/29 (44%), Positives = 14/29 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGP 503 PPPPPP + PPPPP GP Sbjct: 1812 PPPPPPPPPPPPPVVEAPKPPPPPPSEGP 1840 >UniRef50_Q1D416 Cluster: General secretory system II protein E, N-terminal domain protein; n=1; Myxococcus xanthus DK 1622|Rep: General secretory system II protein E, N-terminal domain protein - Myxococcus xanthus (strain DK 1622) Length = 431 Score = 35.1 bits (77), Expect = 2.9 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + + PPP P G PPP Sbjct: 227 PPPPPQAIAVPPQMVQPHVPPPAPALGGSPPP 258 >UniRef50_A5G2K8 Cluster: Putative uncharacterized protein; n=1; Acidiphilium cryptum JF-5|Rep: Putative uncharacterized protein - Acidiphilium cryptum (strain JF-5) Length = 320 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K+ + PPPP PPPP Sbjct: 89 PPPPPPPAPHAAPKLPQPPVPPPP----PPPP 116 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP K PPPPP P P Sbjct: 90 PPPPPPAPHAAPKLPQPPVPPPPPPPPTPAP 120 >UniRef50_A0R2X6 Cluster: Putative uncharacterized protein; n=2; Mycobacterium|Rep: Putative uncharacterized protein - Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) Length = 377 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 54 PPPPPPGGYPPPPQ--GGFPPPPPGGYPPPPP 83 >UniRef50_Q9MAV4 Cluster: F24O1.6; n=10; cellular organisms|Rep: F24O1.6 - Arabidopsis thaliana (Mouse-ear cress) Length = 70 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 19 PRPPPPEPRPPPPPPGPQPPPPPPPRPDPPPP 50 >UniRef50_Q10Q99 Cluster: Transposon protein, putative, unclassified, expressed; n=5; Oryza sativa|Rep: Transposon protein, putative, unclassified, expressed - Oryza sativa subsp. japonica (Rice) Length = 892 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K+ PPPP PPPP Sbjct: 353 PPPPPPPPPPPPPKLNTAPKPPPPP---PPPP 381 >UniRef50_Q10I10 Cluster: Transposon protein, putative, CACTA, En/Spm sub-class, expressed; n=4; Oryza sativa|Rep: Transposon protein, putative, CACTA, En/Spm sub-class, expressed - Oryza sativa subsp. japonica (Rice) Length = 675 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 37 PPPPPPTPSSPQRP----PPPPPPATPPPPPP 64 >UniRef50_Q0JLP7 Cluster: Os01g0584100 protein; n=5; Oryza sativa|Rep: Os01g0584100 protein - Oryza sativa subsp. japonica (Rice) Length = 263 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPPP +K PP PP PPPP Sbjct: 91 QPPPPPPPTTRRSRK-----PPQPPSRPAPPPP 118 >UniRef50_Q01AC1 Cluster: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family; n=2; Ostreococcus tauri|Rep: Meltrins, fertilins and related Zn-dependent metalloproteinases of the ADAMs family - Ostreococcus tauri Length = 872 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G +PP PPP PPPP PPPP Sbjct: 556 GSAARPPSPPPPSPPPPSPPPPSPPPPPSPPPSPPPP 592 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPP P PPPP Sbjct: 572 PSPPPPSPPPPPSPPPSPPPPPSPPPPSPPPP 603 >UniRef50_A7QGU9 Cluster: Chromosome chr16 scaffold_94, whole genome shotgun sequence; n=2; Vitis vinifera|Rep: Chromosome chr16 scaffold_94, whole genome shotgun sequence - Vitis vinifera (Grape) Length = 341 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PPPP Sbjct: 43 PAPPPPPPPPPPPPPPPPPPPPPPPPPPPPPP 74 >UniRef50_Q4QBP0 Cluster: Putative uncharacterized protein; n=1; Leishmania major|Rep: Putative uncharacterized protein - Leishmania major Length = 762 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 348 PPPPPAASVPPPPPAASVPPPPPAVSVPPPP 378 >UniRef50_A7STU3 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 1164 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 572 GMPPPPPPPPPPGFPGG-----APPPPPPPFGAPPPP 603 >UniRef50_A7RKG0 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 404 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 338 PPPPPPPGGAGPPP---PPPPPPPGLPAPPPP 366 >UniRef50_A7RJG2 Cluster: Predicted protein; n=1; Nematostella vectensis|Rep: Predicted protein - Nematostella vectensis Length = 2195 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 949 PPPPPPPGGAGP---PPPPPPPPPGLPAPPPP 977 >UniRef50_A4HCC8 Cluster: Putative uncharacterized protein; n=2; Leishmania|Rep: Putative uncharacterized protein - Leishmania braziliensis Length = 814 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 353 PPPPPAASVPPPPPAASLPPPPPAASVPPPP 383 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 371 PPPPPAASVPPPPPAASLPPPPPAASVPPPP 401 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 380 PPPPPAASLPPPPPAASVPPPPPAASVPPPP 410 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 389 PPPPPAASVPPPPPAASVPPPPPAASVPPPP 419 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 398 PPPPPAASVPPPPPAASVPPPPPAASVPPPP 428 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 344 PPPPPAASLPPPPPAASVPPPPPAASLPPPP 374 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 362 PPPPPAASLPPPPPAASVPPPPPAASLPPPP 392 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 407 PPPPPAASVPPPPPAASVPPPPPAASLPPPP 437 >UniRef50_A2F502 Cluster: Formin Homology 2 Domain containing protein; n=2; Trichomonas vaginalis G3|Rep: Formin Homology 2 Domain containing protein - Trichomonas vaginalis G3 Length = 1139 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP G PPP Sbjct: 600 PPPPPPPPGAAG--LVPPPPPPPPGAGGIPPP 629 Score = 34.3 bits (75), Expect = 5.1 Identities = 17/39 (43%), Positives = 18/39 (46%), Gaps = 2/39 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 G PPPPPP + PPPPP G PPPP Sbjct: 583 GLVPPPPPPPP----PGASLVPPPPPPPPGAAGLVPPPP 617 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP G PPP Sbjct: 638 PPPPPGVPGIPPPPGAPGLPPPPPGVPGIPPP 669 >UniRef50_Q7SCZ7 Cluster: Predicted protein; n=5; Pezizomycotina|Rep: Predicted protein - Neurospora crassa Length = 452 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/36 (44%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPP---PPPXXXGPPPP 512 K PPPPP I PP PPP PPPP Sbjct: 219 KKPPPPPGSRKPSAAIHSSAPPSAPPPPPSFAPPPP 254 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP GPPPP Sbjct: 2 PPPPPPP------------PPPPPGMGGPPPP 21 >UniRef50_Q7RWH7 Cluster: Putative uncharacterized protein NCU01431.1; n=2; Sordariomycetes|Rep: Putative uncharacterized protein NCU01431.1 - Neurospora crassa Length = 1817 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P P P GPPPP Sbjct: 1032 PPPPPPPPPPPPPGFLPGAPAPIPGAGGPPPP 1063 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPP--PXXXGPPPP 512 G PPPPPP + PPPP P G PPP Sbjct: 1089 GPPPPPPPPPPPPMPGMAGMPPPPPPPPPMPGMPGMPPP 1127 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP I PPPP PPPP Sbjct: 1040 PPPPPGFLPGAPAPIPGAGGPPPPPPPPPPPP 1071 >UniRef50_Q6CDQ5 Cluster: Similarity; n=2; Saccharomycetales|Rep: Similarity - Yarrowia lipolytica (Candida lipolytica) Length = 664 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 486 PPPPPPASSRPVPGVPGGVPPPPP----PPPP 513 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPP-PPPXXXGPPPP 512 G PPPPPP PP PPP G PPP Sbjct: 521 GGPPPPPPPPPGAAPSFGSAAPPPPPGPPPAMSGGPPP 558 >UniRef50_Q5ANI0 Cluster: Potential fungal zinc cluster transcription factor; n=1; Candida albicans|Rep: Potential fungal zinc cluster transcription factor - Candida albicans (Yeast) Length = 1130 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 290 PPPPPPHPDHLHHQYYGYPPPPPPP---PPPP 318 >UniRef50_Q0V5Y9 Cluster: Predicted protein; n=1; Phaeosphaeria nodorum|Rep: Predicted protein - Phaeosphaeria nodorum (Septoria nodorum) Length = 305 Score = 35.1 bits (77), Expect = 2.9 Identities = 16/37 (43%), Positives = 18/37 (48%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G ++PPPPPP PPPPP PPPP Sbjct: 90 GYGEQPPPPPPGYAAEP-------PPPPPGMQPPPPP 119 Score = 33.9 bits (74), Expect = 6.8 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKI---XKXXPPPPPXXXGPPPP 512 G + PPPPPP PPPPP PPPP Sbjct: 79 GYGEPPPPPPPGYGEQPPPPPPGYAAEPPPPPPGMQPPPP 118 >UniRef50_A4QQZ5 Cluster: Predicted protein; n=1; Magnaporthe grisea|Rep: Predicted protein - Magnaporthe grisea (Rice blast fungus) (Pyricularia grisea) Length = 477 Score = 35.1 bits (77), Expect = 2.9 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP + PP PP PPPP Sbjct: 336 KASPPPPPPPAAAPPPPEQASPPQPPPAAAPPPP 369 >UniRef50_Q9M1G9 Cluster: Extensin-2 precursor; n=50; Eukaryota|Rep: Extensin-2 precursor - Arabidopsis thaliana (Mouse-ear cress) Length = 743 Score = 35.1 bits (77), Expect = 2.9 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP K + K PPPP PPPP Sbjct: 671 PPPPPCYSPSPKVVYKS-PPPPYVYNSPPPP 700 >UniRef50_Q4RY48 Cluster: Chromosome 3 SCAF14978, whole genome shotgun sequence; n=5; Euteleostomi|Rep: Chromosome 3 SCAF14978, whole genome shotgun sequence - Tetraodon nigroviridis (Green puffer) Length = 1449 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 1080 PPPPPP-----PAPVTGPTPPPPPPPPPPPPP 1106 >UniRef50_Q8VAY0 Cluster: Wsv239; n=1; Shrimp white spot syndrome virus|Rep: Wsv239 - White spot syndrome virus (WSSV) Length = 127 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP PPPPP PPPP Sbjct: 68 PPSPPPPPPFVVPVPFPFVPPPPPSPPPPPPP 99 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PP PPP + PPPPP PPPP F Sbjct: 46 PPSPPPPPPFVVPEPFPFVPPPPP---SPPPPPPF 77 >UniRef50_Q4A2Z7 Cluster: Putative membrane protein precursor; n=1; Emiliania huxleyi virus 86|Rep: Putative membrane protein precursor - Emiliania huxleyi virus 86 Length = 516 Score = 34.7 bits (76), Expect = 3.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP + PPPP PPPP Sbjct: 30 PSPPPPSPPPLPPPLPPPSPPPPSPPPSPPPP 61 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPP PPPP Sbjct: 178 PSPPPPSISPSPPSSASPTPPPPSASPSPPPP 209 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPP P PPPP Sbjct: 54 PPPSPPPPLPPPSPSPPSPPPPSPPPPSPPPP 85 >UniRef50_Q2J3C8 Cluster: OmpA/MotB precursor; n=4; Alphaproteobacteria|Rep: OmpA/MotB precursor - Rhodopseudomonas palustris (strain HaA2) Length = 651 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PP P Sbjct: 104 PPPPPPPRAEPPAAPRAAPPPPPPAAATPPRP 135 >UniRef50_Q0M4S1 Cluster: TonB-like; n=1; Caulobacter sp. K31|Rep: TonB-like - Caulobacter sp. K31 Length = 245 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 71 PPPPPPPPPPPPPPPPTNAPPPPPAVVQPRPP 102 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 69 PPPPPPPP-------PPPPPPPPPPTNAPPPP 93 >UniRef50_A3Q026 Cluster: Putative uncharacterized protein precursor; n=3; Mycobacterium|Rep: Putative uncharacterized protein precursor - Mycobacterium sp. (strain JLS) Length = 210 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 168 PPPPPGAPLPPPPPGAPLPPPPPGAPLPPPP 198 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 177 PPPPPGAPLPPPPPGAPLPPPPPGAPLPPPP 207 >UniRef50_Q7XUV2 Cluster: OSJNBa0072F16.14 protein; n=3; Oryza sativa|Rep: OSJNBa0072F16.14 protein - Oryza sativa subsp. japonica (Rice) Length = 833 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXX----PPPPPXXXGPPPP 512 PPPPPP + + PPPPP PPPP Sbjct: 372 PPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPP 407 >UniRef50_Q2R360 Cluster: C2 domain containing protein, expressed; n=1; Oryza sativa (japonica cultivar-group)|Rep: C2 domain containing protein, expressed - Oryza sativa subsp. japonica (Rice) Length = 347 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/40 (40%), Positives = 17/40 (42%), Gaps = 4/40 (10%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP----XXXGPPPPXXFF 524 PPPPPP PPPPP PPPP F+ Sbjct: 213 PPPPPPHVTQSFAPNSSYPPPPPPSQYIAGYPPPPPSNFY 252 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/35 (42%), Positives = 17/35 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP + PPPPP PPPP + Sbjct: 231 PPPPPP------SQYIAGYPPPPPSNFYPPPPAGY 259 >UniRef50_Q09084 Cluster: Extensin (Class II) precursor; n=3; Solanum lycopersicum|Rep: Extensin (Class II) precursor - Solanum lycopersicum (Tomato) (Lycopersicon esculentum) Length = 322 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 + PPPPP K PP PP PPPP Sbjct: 208 QSPPPPPTPSYEHPKTPSHPTPPTPPCNEPPPPP 241 >UniRef50_O23370 Cluster: Cell wall protein like; n=15; Magnoliophyta|Rep: Cell wall protein like - Arabidopsis thaliana (Mouse-ear cress) Length = 428 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/36 (41%), Positives = 17/36 (47%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 KPPPPP + PPPPP PPPP + Sbjct: 96 KPPPPPTVKPPPPPYV---KPPPPPTVKPPPPPTPY 128 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/34 (44%), Positives = 16/34 (47%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPP K PPPPP PPPP + Sbjct: 105 PPPPPYVKPPPPPTVK--PPPPPTPYTPPPPTPY 136 Score = 34.3 bits (75), Expect = 5.1 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP K PPPPP PPPP Sbjct: 89 PPPPPYVKPPPPPTVK--PPPPPYVKPPPPP 117 Score = 33.9 bits (74), Expect = 6.8 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KPPPPP + PPPP PPPP Sbjct: 144 KPPPPPVVTPPPPTPTPEAPCPPPPPTPYPPPP 176 Score = 33.5 bits (73), Expect = 8.9 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 414 KPPPP--PPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KPPPP P K PPPPP PPPP Sbjct: 67 KPPPPYIPCPPPPYTPKPPTVKPPPPPYVKPPPPP 101 >UniRef50_Q7KUL0 Cluster: CG9425-PB, isoform B; n=4; Diptera|Rep: CG9425-PB, isoform B - Drosophila melanogaster (Fruit fly) Length = 2103 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPP PPPPP PPP F Sbjct: 1597 PPPPPYLRHNGSGYNPGAPPPPPQQQPQPPPNPF 1630 >UniRef50_Q60R78 Cluster: Putative uncharacterized protein CBG21491; n=1; Caenorhabditis briggsae|Rep: Putative uncharacterized protein CBG21491 - Caenorhabditis briggsae Length = 429 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 310 GAPGSPPPPPPSGAPPTGS----PPPPPPQSGGSPPP 342 >UniRef50_Q5DGR5 Cluster: SJCHGC08168 protein; n=1; Schistosoma japonicum|Rep: SJCHGC08168 protein - Schistosoma japonicum (Blood fluke) Length = 134 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/37 (43%), Positives = 16/37 (43%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPX-----XXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 58 PPPPPPSSIVGAKDTKPLLPPPPPPPPAFSLGAPPPP 94 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K K PPPP PPPP Sbjct: 57 PPPPPPPSSIVGAKDTKPLLPPPP----PPPP 84 >UniRef50_Q54H12 Cluster: Actin-binding protein; n=2; Dictyostelium discoideum|Rep: Actin-binding protein - Dictyostelium discoideum AX4 Length = 1220 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPP GPPPP Sbjct: 591 GGGPPPPPPPPMMGGGGPP---PPPPPPMMGGGPPPP 624 >UniRef50_Q16PS7 Cluster: Cxyorf1; n=3; Culicidae|Rep: Cxyorf1 - Aedes aegypti (Yellowfever mosquito) Length = 462 Score = 34.7 bits (76), Expect = 3.9 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PP + PPPPP PPPP Sbjct: 303 PPMPPIAAPAPNVVINAQPPPPPPPPPPPPP 333 >UniRef50_A2D765 Cluster: Putative uncharacterized protein; n=1; Trichomonas vaginalis G3|Rep: Putative uncharacterized protein - Trichomonas vaginalis G3 Length = 450 Score = 34.7 bits (76), Expect = 3.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP + PPPPP PPPP Sbjct: 320 PPPPAAKPAPPPPRAAAPPPPPPPAAAAPPPP 351 Score = 33.5 bits (73), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 337 PPPPPPPAAAAP-------PPPPPPMAAPPPP 361 >UniRef50_Q2GRR5 Cluster: Putative uncharacterized protein; n=1; Chaetomium globosum|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 1026 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P + PPPPP GPPPP Sbjct: 928 PPPPAPPLIVPPPVPLRPVPPPPPT--GPPPP 957 >UniRef50_Q2GNY9 Cluster: Putative uncharacterized protein; n=2; Sordariomycetes|Rep: Putative uncharacterized protein - Chaetomium globosum (Soil fungus) Length = 813 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP PPPP Sbjct: 387 GASASPPPPPP---------SEAAPPPPPPSAAPPPP 414 >UniRef50_A7EKZ0 Cluster: Putative uncharacterized protein; n=1; Sclerotinia sclerotiorum 1980|Rep: Putative uncharacterized protein - Sclerotinia sclerotiorum 1980 Length = 1373 Score = 34.7 bits (76), Expect = 3.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PPPP Sbjct: 1292 PPPPPMPSAGAPGGPPPPPPPPPPGMGAPPPP 1323 >UniRef50_A6SD70 Cluster: Putative uncharacterized protein; n=1; Botryotinia fuckeliana B05.10|Rep: Putative uncharacterized protein - Botryotinia fuckeliana B05.10 Length = 1648 Score = 34.7 bits (76), Expect = 3.9 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 983 GPPPPPPPPPPMPGQGPPGFNGPPPPPPP----PPPP 1015 Score = 33.5 bits (73), Expect = 8.9 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP PPPP Sbjct: 1007 PPPPPPPPPGMNAPVAPGFGGPPPPPPPPPPP 1038 >UniRef50_A2R7D2 Cluster: Contig An16c0100, complete genome; n=1; Aspergillus niger|Rep: Contig An16c0100, complete genome - Aspergillus niger Length = 692 Score = 34.7 bits (76), Expect = 3.9 Identities = 15/34 (44%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPP--PXXXGPPP 509 +PPPPPP PPPP P GPPP Sbjct: 139 QPPPPPPPHPHPHHHYPPPPPPPPHHPPFFGPPP 172 >UniRef50_Q09493 Cluster: Putative uncharacterized protein shn-1; n=3; Caenorhabditis|Rep: Putative uncharacterized protein shn-1 - Caenorhabditis elegans Length = 1110 Score = 30.7 bits (66), Expect(2) = 4.2 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PP PPPP Sbjct: 767 PPPPPPPPHCEPTMVHVEFTPPSTSSVPPPPP 798 Score = 22.6 bits (46), Expect(2) = 4.2 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 411 KKPPPPPP 434 K PPPPPP Sbjct: 722 KTPPPPPP 729 >UniRef50_Q7YYP6 Cluster: Hydroxyproline-rich glycoprotein dz-hrgp, probable; n=4; Eukaryota|Rep: Hydroxyproline-rich glycoprotein dz-hrgp, probable - Cryptosporidium parvum Length = 832 Score = 31.1 bits (67), Expect(2) = 4.3 Identities = 12/29 (41%), Positives = 13/29 (44%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPP 488 G PPPPPP + PPPPP Sbjct: 647 GELPLPPPPPPLEEPLSSPSDEPLPPPPP 675 Score = 22.2 bits (45), Expect(2) = 4.3 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = +3 Query: 477 PPPPXXXGPPPP 512 P PP PPPP Sbjct: 703 PAPPPTSAPPPP 714 >UniRef50_UPI00015B5C8A Cluster: PREDICTED: similar to formin 1,2/cappuccino; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to formin 1,2/cappuccino - Nasonia vitripennis Length = 1271 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/38 (42%), Positives = 16/38 (42%), Gaps = 1/38 (2%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPP-PPXXXGPPPP 512 G PPPPPP PPP P GPPPP Sbjct: 578 GMMSGPPPPPPPMPEMMSGPPPPPPPPMPGMMSGPPPP 615 >UniRef50_UPI00015B4302 Cluster: PREDICTED: similar to Wiskott-Aldrich syndrome; n=1; Nasonia vitripennis|Rep: PREDICTED: similar to Wiskott-Aldrich syndrome - Nasonia vitripennis Length = 530 Score = 34.3 bits (75), Expect = 5.1 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP K+ PPPPP Sbjct: 381 PPPPPPMPQELPSKVVTNAPPPPP 404 >UniRef50_UPI0000F205BB Cluster: PREDICTED: similar to formin 2; n=2; Danio rerio|Rep: PREDICTED: similar to formin 2 - Danio rerio Length = 1465 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P + K PPPP PPPP Sbjct: 935 PPPPLPGFVPPPPVVGKAPPPPPLPGMVPPPP 966 Score = 33.5 bits (73), Expect = 8.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP K PPPPP PPP Sbjct: 916 PPPPPLSGMTPPKPTGVIPPPPPLPGFVPPP 946 >UniRef50_UPI0000E7FD76 Cluster: PREDICTED: similar to SH3 domain binding protein; n=1; Gallus gallus|Rep: PREDICTED: similar to SH3 domain binding protein - Gallus gallus Length = 254 Score = 34.3 bits (75), Expect = 5.1 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP GPPPP Sbjct: 4 PPPPPPPP-----------PPPPPPSGGPPPP 24 >UniRef50_UPI0000E47360 Cluster: PREDICTED: hypothetical protein; n=1; Strongylocentrotus purpuratus|Rep: PREDICTED: hypothetical protein - Strongylocentrotus purpuratus Length = 1032 Score = 34.3 bits (75), Expect = 5.1 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 926 PPPPPPPPQAALPPPPPPGPPPAPDAALPPPP 957 Score = 33.9 bits (74), Expect = 6.8 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP + PPPP PPPP Sbjct: 911 PPAPPPPPLLSEAPLPPPPPPPPQAALPPPPP 942 Database: uniref50 Posted date: Oct 5, 2007 11:19 AM Number of letters in database: 575,637,011 Number of sequences in database: 1,657,284 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 519,133,515 Number of Sequences: 1657284 Number of extensions: 8977842 Number of successful extensions: 93751 Number of sequences better than 10.0: 351 Number of HSP's better than 10.0 without gapping: 25597 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 63247 length of database: 575,637,011 effective HSP length: 101 effective length of database: 408,251,327 effective search space used: 97163815826 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -