BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_E17 (1019 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 02_05_0686 - 30900748-30902167,30903442-30904742 41 0.002 12_02_1174 - 26696869-26698191 40 0.003 07_01_0080 + 587674-588510 40 0.003 02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363,329... 40 0.004 05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-18... 39 0.006 03_01_0515 - 3864796-3865425 39 0.006 10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379,121... 38 0.017 01_06_1377 + 36764461-36765339 37 0.022 08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132,330... 37 0.030 07_03_0890 - 22332768-22333382 37 0.030 03_06_0338 + 33240111-33240860,33241248-33241536,33242494-33242621 36 0.052 03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686,542... 35 0.091 01_05_0490 + 22672241-22674679 35 0.091 09_04_0081 - 14400293-14400397,14400953-14401036,14401144-144012... 35 0.12 04_04_0137 - 23053148-23053798,23053911-23054146,23054268-230544... 35 0.12 01_06_1678 - 39095986-39096205,39096400-39096477,39096578-390969... 34 0.16 10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223,996... 34 0.21 08_01_0059 - 394001-394708 34 0.21 08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560,336... 34 0.21 04_03_0660 + 18463011-18463322,18463424-18463516,18464500-184646... 34 0.21 06_03_0696 + 23617687-23617851,23618838-23619536 33 0.28 04_04_0233 + 23801944-23802598,23802914-23803047,23803548-238037... 33 0.28 04_01_0034 - 401208-402923 33 0.28 05_01_0131 + 888247-888771,889092-889154 33 0.37 04_04_1641 + 34993807-34994589,34994924-34995022,34995521-349956... 33 0.37 01_06_0823 + 32234588-32234936,32236354-32237093,32237260-322373... 33 0.37 07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828,504... 32 0.64 06_03_0683 - 23490215-23490997 32 0.64 05_07_0332 - 29332520-29332818,29333511-29333725,29334380-293344... 32 0.64 12_02_0370 + 18139557-18140469,18140561-18140704,18140804-181409... 32 0.85 12_01_0135 + 1042889-1044255,1045368-1045809 32 0.85 11_01_0133 + 1121392-1122731,1123417-1123858 32 0.85 03_05_1153 + 30787574-30787608,30787982-30788089,30788651-307886... 32 0.85 03_02_0738 - 10824121-10825572 32 0.85 02_05_1057 + 33809982-33810366,33810436-33810687,33810727-338109... 32 0.85 09_02_0603 - 11150739-11150746,11150791-11151340 31 1.1 09_02_0543 + 10427321-10428315,10428440-10429154 31 1.1 07_03_1636 + 28290642-28291574 31 1.1 07_01_0862 - 7172083-7172931 31 1.1 03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223,863... 31 1.1 01_07_0021 - 40533864-40534583,40534779-40534814,40534909-405350... 31 1.1 09_02_0327 - 7284829-7284889,7284946-7286126 31 1.5 07_01_0516 - 3850252-3852870 31 1.5 04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062,943... 31 1.5 03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 31 1.5 03_06_0399 - 33632811-33633107,33633236-33633385,33633705-336340... 31 1.5 03_01_0178 + 1437263-1438017,1438754-1438858,1438950-1439072,143... 31 1.5 02_04_0400 - 22608519-22608844,22609044-22609122 31 1.5 10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364,955... 27 1.8 01_07_0188 - 41866689-41866763,41866889-41867155,41867277-418677... 27 1.8 01_06_0642 + 30811708-30811768,30812256-30812305,30812455-308129... 28 1.8 09_01_0037 - 604001-604957 28 1.9 12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-27... 31 2.0 11_06_0610 - 25449085-25453284 31 2.0 07_03_1147 + 24349811-24350161,24351031-24351366,24353260-243533... 31 2.0 06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 31 2.0 03_05_0524 - 25181432-25181483,25181565-25181691,25181776-251818... 31 2.0 03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500,597... 31 2.0 03_06_0289 - 32870581-32871238,32871271-32871275 28 2.0 03_02_0045 - 5251234-5251305,5251362-5251419,5252256-5252539,525... 27 2.5 12_01_0753 + 6810239-6810661,6812495-6812584,6812724-6812894,681... 30 2.6 11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-25... 30 2.6 10_08_0608 + 19184722-19185224,19185331-19185410,19186048-191862... 30 2.6 09_04_0506 - 18188785-18190599 30 2.6 09_02_0369 - 8012470-8013120 30 2.6 08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560,468... 30 2.6 07_03_0792 - 21541301-21542143,21542426-21542661,21543177-215433... 30 2.6 06_01_0931 + 7192519-7194075 30 2.6 04_03_1022 - 21778315-21779007 30 2.6 04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 30 2.6 03_05_0067 - 20460206-20460703,20461255-20461530 30 2.6 02_04_0567 - 23914330-23914461,23915016-23915136,23915954-239160... 30 2.6 01_06_1670 - 39007402-39008229,39008320-39008567,39009159-390093... 30 2.6 03_03_0038 + 13984525-13984917,13985351-13985429,13985535-139856... 25 2.6 12_02_1036 - 25587313-25587890,25589209-25589272,25589356-255894... 30 3.4 12_01_0838 - 7830944-7831444 30 3.4 11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 30 3.4 07_03_1573 + 27829967-27830338,27830821-27831510,27831594-278317... 30 3.4 07_03_0600 + 19866757-19867218,19867920-19868429 30 3.4 05_07_0125 + 27861368-27862282 30 3.4 04_04_0760 - 27837170-27837328,27837441-27837504,27837812-278381... 30 3.4 03_05_0919 - 28792790-28792915,28793090-28793155,28794345-287945... 30 3.4 01_06_0090 + 26358051-26359157,26359582-26359701,26359968-263600... 30 3.4 01_03_0005 + 11568545-11569119,11569179-11569191 30 3.4 01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748,332... 30 3.4 12_02_0299 - 17051570-17052474,17053542-17053755 29 4.5 11_06_0188 + 21036465-21036627,21036735-21036883,21037369-210374... 29 4.5 11_01_0359 - 2731522-2732346 29 4.5 06_02_0175 - 12624608-12625297 29 4.5 06_01_0486 - 3455030-3455770 29 4.5 04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 29 4.5 03_06_0427 - 33857008-33857137,33857224-33857258,33857966-338580... 29 4.5 02_04_0005 - 18843061-18843201,18843309-18843440,18844457-188453... 29 4.5 01_01_0083 + 631196-631675 29 4.5 01_06_0046 + 25943183-25943590 26 4.7 02_04_0382 - 22501041-22501279,22501717-22501810 24 4.8 01_01_0796 + 6190931-6192745 26 5.2 12_02_1219 + 27096477-27096590,27096704-27097078 29 6.0 11_01_0066 - 536281-537196,537397-537452 29 6.0 10_08_0630 - 19410852-19411235,19411370-19412257,19412440-194129... 29 6.0 08_02_1084 - 24232968-24234779 29 6.0 08_01_0202 - 1638978-1639571 29 6.0 07_03_0329 + 16840051-16840917,16840999-16841342,16841444-168415... 29 6.0 07_03_0177 - 14770777-14772045 29 6.0 07_01_0753 - 5799733-5799741,5799938-5800642 29 6.0 06_03_0790 - 24636805-24637770 29 6.0 06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 29 6.0 05_07_0100 + 27679280-27680320 29 6.0 05_01_0380 + 2978256-2979284 29 6.0 05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385,365... 29 6.0 04_04_0057 + 22410167-22411330 29 6.0 03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468,593... 29 6.0 01_01_0715 - 5542648-5543219,5543352-5543544 29 6.0 03_03_0278 - 16126803-16129049 25 6.6 05_07_0200 - 28368890-28369021,28369169-28369303,28369918-283699... 25 6.6 03_06_0758 - 36052261-36052301,36052463-36052697,36052895-360529... 25 7.0 11_06_0016 - 19284810-19284926,19285527-19286879 29 7.9 11_01_0621 - 4981070-4981136,4982906-4983825 29 7.9 10_08_0738 - 20212220-20212282,20212387-20212593,20212690-202128... 29 7.9 09_04_0684 - 19442335-19442990,19443774-19443839,19443935-194440... 29 7.9 07_03_1136 + 24218601-24218734,24218769-24219906 29 7.9 07_03_0559 + 19475893-19476783 29 7.9 07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991,615... 29 7.9 06_03_0310 - 19453047-19453160,19453240-19453338,19453441-194535... 29 7.9 05_07_0031 - 27183252-27183317,27183542-27184282 29 7.9 03_05_0161 + 21400580-21401695 29 7.9 02_01_0713 - 5332145-5332351,5332675-5332893,5334347-5334559,533... 29 7.9 02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 29 7.9 01_07_0380 + 43181564-43181639,43182053-43182218,43182494-431826... 29 7.9 01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 29 7.9 12_02_0072 + 13218669-13218706,13218715-13218781,13220400-132204... 25 9.3 >02_05_0686 - 30900748-30902167,30903442-30904742 Length = 906 Score = 40.7 bits (91), Expect = 0.002 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 326 PPPPPPPKAAPPPPPPKGPPPPPPAKGPPPPP 357 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 336 PPPPPPKGPPPPPPAKGPPPPPPPKGPSPPPP 367 Score = 36.7 bits (81), Expect = 0.030 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 313 PPPPPP-----PKPAAAAPPPPPPPKAAPPPP 339 Score = 35.9 bits (79), Expect = 0.052 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP K PPPPP PPP Sbjct: 333 KAAPPPPPPKGPPPPPPAKGPPPPPPPKGPSPPP 366 Score = 34.7 bits (76), Expect = 0.12 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIX---KXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 314 PPPPPPKPAAAAPPPPPPPKAAPPPPPPKGPPPPP 348 Score = 31.9 bits (69), Expect = 0.85 Identities = 16/34 (47%), Positives = 16/34 (47%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPPP K PPPP G PPP Sbjct: 351 KGPPPPPPP-----KGPSPPPPPPPGGKKGGPPP 379 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP G P Sbjct: 364 PPPPPPPGGK------KGGPPPPPPKGGASRP 389 >12_02_1174 - 26696869-26698191 Length = 440 Score = 39.9 bits (89), Expect = 0.003 Identities = 14/37 (37%), Positives = 20/37 (54%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 +PPPPPP ++ + P PPP PPPP ++ Sbjct: 245 QPPPPPPRAPVKMPRVLEPKPSPPPPSPLPPPPEDYW 281 Score = 35.1 bits (77), Expect = 0.091 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + + P PPP P PP Sbjct: 160 PPPPPPRPPSVKPPVVQPKPQPPPSLQPPSPP 191 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/33 (42%), Positives = 16/33 (48%), Gaps = 1/33 (3%) Frame = +3 Query: 417 PPPPPPXXXXXXKK-IXKXXPPPPPXXXGPPPP 512 PPPPPP K + + P PPP P PP Sbjct: 190 PPPPPPTRPPSVKPPVVQPKPQPPPTLPPPSPP 222 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/34 (41%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXP--PPPPXXXGPPPP 512 PPPPPP + + P P PP PPPP Sbjct: 124 PPPPPPRTRTRVEPPHRPPPVKPQPPPSLPPPPP 157 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P K PPP PPPP Sbjct: 162 PPPPRPPSVKPPVVQPKPQPPPSLQPPSPPPP 193 >07_01_0080 + 587674-588510 Length = 278 Score = 39.9 bits (89), Expect = 0.003 Identities = 17/40 (42%), Positives = 19/40 (47%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 G ++PPPPPP PPPPP PPPP F Sbjct: 86 GMFRRPPPPPPPPPSSGS--PPPPPPPPPPPPPPPPPPLF 123 >02_01_0458 + 3291563-3291733,3292082-3292769,3292847-3293363, 3293438-3293637,3294137-3294372,3294469-3295302 Length = 881 Score = 39.5 bits (88), Expect = 0.004 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP G PPP Sbjct: 356 PPPPPPPPPPPPPPPPRPPPPPPPIKKGAPPP 387 Score = 31.5 bits (68), Expect = 1.1 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP PPPPP PPPP Sbjct: 350 KLMPPPPPPPPPP----PPPPPPPPPRPPPPPPP 379 >05_01_0028 + 182528-183852,183967-184127,184872-185116,185330-186073 Length = 824 Score = 39.1 bits (87), Expect = 0.006 Identities = 14/31 (45%), Positives = 17/31 (54%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP ++ + PPPPP PPPP Sbjct: 72 PPPPPPAPRPPRRHHRIPPPPPPLLPTPPPP 102 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP + PPPPP PPP Sbjct: 70 PTPPPPPPAPRPPRRHHRIPPPPPPLLPTPPP 101 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP P P P PP P Sbjct: 89 PPPPPPLLPTPPPPPASISPTPAPPLPPPPAP 120 >03_01_0515 - 3864796-3865425 Length = 209 Score = 39.1 bits (87), Expect = 0.006 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 71 PPPPPPPSVTSSPPPPPLPPPPPPPAASPPPP 102 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPP P PPPP Sbjct: 89 PPPPPPPAASPPPPPPSPPPPSPVKSSPPPP 119 Score = 30.7 bits (66), Expect = 2.0 Identities = 15/38 (39%), Positives = 15/38 (39%), Gaps = 2/38 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPX--XXGPPP 509 G PPPPPP PPPPP PPP Sbjct: 67 GPLMPPPPPPPSVTSSPPPPPLPPPPPPPAASPPPPPP 104 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PP P Sbjct: 83 PPPPPLPPPPPPPAAS--PPPPPPSPPPPSP 111 >10_01_0100 + 1209424-1209538,1210373-1211073,1211158-1211379, 1211452-1211878,1212091-1213219,1213623-1213746, 1214207-1214278,1215480-1215578,1215617-1215640, 1215704-1215745,1215815-1215895,1215983-1216114, 1216115-1216196,1216271-1216365,1218499-1218570, 1218676-1218792,1219379-1219447,1219521-1219587, 1219886-1220025 Length = 1269 Score = 37.5 bits (83), Expect = 0.017 Identities = 16/32 (50%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP PPPP Sbjct: 546 PPPPPPPPPSGNKPAFSPPPPPPPP---PPPP 574 Score = 36.3 bits (80), Expect = 0.039 Identities = 15/35 (42%), Positives = 17/35 (48%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG---PPPP 512 PPPPPP + + PPPPP PPPP Sbjct: 603 PPPPPPPPILPNRSVPPPPPPPPPLPNHSVLPPPP 637 Score = 35.5 bits (78), Expect = 0.069 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 544 PPPPPPPPPPPSGNKPAFSPPPPPPPPPPPP 574 Score = 35.5 bits (78), Expect = 0.069 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 566 PPPPPPPPPLPQSNYASSQPPPPP----PPPP 593 Score = 33.5 bits (73), Expect = 0.28 Identities = 15/36 (41%), Positives = 16/36 (44%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGP----PPP 512 PPPPPP + PPPPP P PPP Sbjct: 618 PPPPPPPPPLPNHSVLPPPPPPPPPPSLPNRLVPPP 653 Score = 32.7 bits (71), Expect = 0.48 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGP----PPP 512 +PPPPPP + PPPPP P PPP Sbjct: 584 QPPPPPPPPPLPNCLVPSPPPPPPPPPILPNRSVPPP 620 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 + PP PPP KK PPPPP PP Sbjct: 745 RNPPAPPPPPLMTGKKAPAP-PPPPPQAPKPP 775 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPPP + P P PPPP Sbjct: 687 KGPPPPPPPPLPPANRTNGPGVPSAPPPPPPPPP 720 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG-----PPPP 512 PP PPP K+ PPPPP G PPPP Sbjct: 732 PPLPPPLPAAANKR-NPPAPPPPPLMTGKKAPAPPPP 767 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP---XXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 569 PPPPPPLPQSNYASSQPPPPPPPPPLPNCLVPSPP 603 Score = 29.5 bits (63), Expect = 4.5 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 5/37 (13%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG-----PPPP 512 PPPPPP ++ PPPP G PPPP Sbjct: 635 PPPPPPPPPSLPNRL---VPPPPAPGIGNKFPAPPPP 668 Score = 29.5 bits (63), Expect = 4.5 Identities = 16/35 (45%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPP----PXXXGPPPP 512 PPPPP KK PPPP P PPPP Sbjct: 750 PPPPPL--MTGKKAPAPPPPPPQAPKPPGTVPPPP 782 >01_06_1377 + 36764461-36765339 Length = 292 Score = 37.1 bits (82), Expect = 0.022 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 + PPPP P PPPPP PPPP Sbjct: 153 RSPPPPEPQYPPPSSSPYYFPPPPPPAYSAPPPP 186 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/37 (32%), Positives = 15/37 (40%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 ++ PPPP PPPPP PPP + Sbjct: 152 ERSPPPPEPQYPPPSSSPYYFPPPPPPAYSAPPPPQY 188 >08_01_0375 - 3307206-3307316,3307870-3307965,3308061-3308132, 3308247-3308315,3308427-3308513,3308753-3308858, 3309118-3309237,3309327-3309406,3309497-3309878, 3310746-3310814,3311460-3312202 Length = 644 Score = 36.7 bits (81), Expect = 0.030 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 93 PPPPPPYGVNSSQPPPPPPPPPSPPPSAPPPP 124 Score = 34.3 bits (75), Expect = 0.16 Identities = 13/36 (36%), Positives = 16/36 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP + P PP PPPP ++ Sbjct: 55 PPPPPPGPPPPHQPQFNFGPGPPQQQQPPPPPQMYY 90 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/36 (38%), Positives = 14/36 (38%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 G PPPPP PPPPP PPP Sbjct: 100 GVNSSQPPPPPPPPPSPP--PSAPPPPPPPPTQPPP 133 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXP---PPPPXXXGPPPP 512 PPP P P PPPP GPPPP Sbjct: 31 PPPQQPAYGHMPPPQGAPPPFLAPPPPPPPGPPPP 65 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPP PPPP Sbjct: 112 PPPSPPPSAPPPPPPPPTQPPPREAQLAPPPP 143 >07_03_0890 - 22332768-22333382 Length = 204 Score = 36.7 bits (81), Expect = 0.030 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP P PP Sbjct: 87 PPPPPPPERAVPEAADTPPPPPPPTAPTPTPP 118 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP P P Sbjct: 86 PPPPPPPPERAVPEAADTPPPPPPPTAPTPTP 117 >03_06_0338 + 33240111-33240860,33241248-33241536,33242494-33242621 Length = 388 Score = 35.9 bits (79), Expect = 0.052 Identities = 15/34 (44%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KKPPPPP K PPPP PP P Sbjct: 176 KKPPPPPEAHHRPTKSYTGHPPPPPLEKDAPPQP 209 >03_02_0071 + 5425722-5427154,5427259-5427464,5428445-5428686, 5428788-5429570 Length = 887 Score = 35.1 bits (77), Expect = 0.091 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K+ PPPP PPPP Sbjct: 353 PPPPPPPPPPPPPKLNTAPKPPPPP---PPPP 381 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/29 (44%), Positives = 13/29 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGP 503 PPPPPP K PPPPP P Sbjct: 356 PPPPPPPPPPKLNTAPKPPPPPPPPPSVP 384 Score = 25.4 bits (53), Expect(2) = 3.9 Identities = 9/22 (40%), Positives = 10/22 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPP 482 PPPPPP + K PP Sbjct: 375 PPPPPPPSVPSNNNLPKPAEPP 396 Score = 22.6 bits (46), Expect(2) = 3.9 Identities = 7/8 (87%), Positives = 7/8 (87%) Frame = +3 Query: 411 KKPPPPPP 434 K PPPPPP Sbjct: 372 KPPPPPPP 379 >01_05_0490 + 22672241-22674679 Length = 812 Score = 35.1 bits (77), Expect = 0.091 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPPPPP +K PP PP PPPP Sbjct: 640 QPPPPPPPTTRRSRK-----PPQPPSRPAPPPP 667 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPP---PXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP P + P PPP PPPP Sbjct: 666 PPPPPQQQPPFYPRRAVVYYTYPLPPPSPPLPPPP 700 >09_04_0081 - 14400293-14400397,14400953-14401036,14401144-14401214, 14401293-14401380,14401487-14401678,14401772-14402704 Length = 490 Score = 34.7 bits (76), Expect = 0.12 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPPP + PPPPP P PP Sbjct: 217 KGAPPPPPPPPPSPHRHPAAHPPPPPHHPAPRPP 250 >04_04_0137 - 23053148-23053798,23053911-23054146,23054268-23054458, 23054587-23056010 Length = 833 Score = 34.7 bits (76), Expect = 0.12 Identities = 15/36 (41%), Positives = 17/36 (47%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXX----PPPPPXXXGPPPP 512 PPPPPP + + PPPPP PPPP Sbjct: 372 PPPPPPPAVTQQQDVKTSCGPAVPPPPPPTPPPPPP 407 >01_06_1678 - 39095986-39096205,39096400-39096477,39096578-39096949, 39097374-39097671,39097867-39098077,39098331-39099023 Length = 623 Score = 34.3 bits (75), Expect = 0.16 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 123 PPPHPPEDPPPHPPHPPDHPPPPPPCRVPPPP 154 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP + PP PP PPPP Sbjct: 116 PPRPPPPPPPHPPEDPPPHPPHPPDHPPPPPP 147 >10_06_0039 - 9966744-9967535,9968241-9968482,9969021-9969223, 9969333-9970645 Length = 849 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K PPPPP P PP Sbjct: 331 PPPPPPPPSRFNNTTPKPPPPPPP----PEPP 358 >08_01_0059 - 394001-394708 Length = 235 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPP P PPPP Sbjct: 17 PPPPPRRAPPPPSPPIRPPPPPTPRPYAPPPP 48 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPP PPPP Sbjct: 26 PPPSPPIRPPPPPTPRPYAPPPPSHPLAPPPP 57 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 2 PPPPPP-----RRAPPPPATPPPPPRRAPPPP 28 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPP---PXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP P + PPPP PPPP Sbjct: 3 PPPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPP 37 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPP---PPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PP + PPP P PPPP Sbjct: 4 PPPPRRAPPPPATPPPPPRRAPPPPSPPIRPPPPP 38 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/37 (37%), Positives = 15/37 (40%), Gaps = 3/37 (8%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPP---PXXXGPPPP 512 + PPPP P PPPP P PPPP Sbjct: 33 RPPPPPTPRPYAPPPPSHPLAPPPPHISPPAPVPPPP 69 >08_01_0003 + 30085-30195,30289-30365,31080-31136,31668-33560, 33643-34147,34250-34358,34436-34548,34619-34806, 35481-36129,36169-36691,36760-36911,37042-37141, 37301-37416 Length = 1530 Score = 33.9 bits (74), Expect = 0.21 Identities = 15/31 (48%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP GPPP Sbjct: 1169 PPPPPPLSPSLPPP-----PPPPPLPSGPPP 1194 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/36 (38%), Positives = 14/36 (38%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPP----PPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PP PP PP PPPP Sbjct: 1138 PPPPLPEGPPPLPSDSPPCQPPLPPSPPPATPPPPP 1173 >04_03_0660 + 18463011-18463322,18463424-18463516,18464500-18464607, 18464892-18465044,18465256-18465354,18465443-18465571, 18465987-18466166,18466208-18466246,18466247-18466363, 18466445-18466609 Length = 464 Score = 33.9 bits (74), Expect = 0.21 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PPPPP PPPP Sbjct: 38 PPPPARHRAPSPPRPPPPPPPPTQPAPPPP 67 >06_03_0696 + 23617687-23617851,23618838-23619536 Length = 287 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPP Sbjct: 78 PPPPPPPPPPSPPATHDVGQPPPPPSLAAPPP 109 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/33 (42%), Positives = 14/33 (42%), Gaps = 2/33 (6%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXK--XXPPPPPXXXGPPP 509 PPPPPP PPPPP PPP Sbjct: 77 PPPPPPPPPPPSPPATHDVGQPPPPPSLAAPPP 109 >04_04_0233 + 23801944-23802598,23802914-23803047,23803548-23803730, 23804145-23804318 Length = 381 Score = 33.5 bits (73), Expect = 0.28 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP P + PPPPP PPPP Sbjct: 9 PPPTPSPPPFSSRPRVVGPPPPPPSDPPPPP 39 Score = 32.7 bits (71), Expect = 0.48 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP P + PPPPP PPPP Sbjct: 9 PPPTPSPPPFSSRPRVVGPPPPPPSDPPPPPP 40 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP P P ++ PPPP PPPP Sbjct: 10 PPTPSPPPFSSRPRVVGPPPPPPSDPPPPPPP 41 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/34 (38%), Positives = 16/34 (47%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXK--XXPPPPPXXXGPPPP 512 PPPPPP ++ + P P P PPPP Sbjct: 36 PPPPPPHHHHHHRRRHRHSKKPKPQPQPQPPPPP 69 >04_01_0034 - 401208-402923 Length = 571 Score = 33.5 bits (73), Expect = 0.28 Identities = 14/31 (45%), Positives = 16/31 (51%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP ++ PPPPP PPP Sbjct: 307 PPPPPPQQ----QRAKPSRPPPPPPPLDPPP 333 >05_01_0131 + 888247-888771,889092-889154 Length = 195 Score = 33.1 bits (72), Expect = 0.37 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + K P P PPPP Sbjct: 80 PPPPPPSTPTQFSVLRKVPTGPDPITSDPPPP 111 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + P P PPPP Sbjct: 134 PPPPPPLSEFPVLREVPSGPDPITSDPPPPPP 165 >04_04_1641 + 34993807-34994589,34994924-34995022,34995521-34995648, 34996095-34996235,34996456-34996542,34996627-34996780, 34998569-34998628,34999019-34999447,34999524-34999819, 35000278-35000407,35000690-35001187 Length = 934 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP P PP Sbjct: 38 PPPPPP------SPVPSPAPPPPPHRPSPSPP 63 >01_06_0823 + 32234588-32234936,32236354-32237093,32237260-32237343, 32237909-32239263,32240399-32240460,32240544-32241144, 32241229-32241310,32241778-32241840 Length = 1111 Score = 33.1 bits (72), Expect = 0.37 Identities = 14/33 (42%), Positives = 16/33 (48%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 K+PPPPPP + PPPP PPP Sbjct: 962 KRPPPPPPPPNVAPPPFTRQDIPPPP--PSPPP 992 >07_01_0674 + 5047503-5047646,5047808-5047901,5048743-5048828, 5049380-5049429,5049517-5049586,5049668-5049749, 5049867-5050267,5050414-5050941,5051823-5052044 Length = 558 Score = 32.3 bits (70), Expect = 0.64 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPP P + PPPPP GPPP Sbjct: 234 PPPPKPANIAGAPGLPLPPPPPPP--PGPPP 262 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + + PP PPPP Sbjct: 205 PPPPPPPLPASSEPVDPSAASLPPLPPPPPPP 236 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPP Sbjct: 231 PPPPPPPKPANIAGAPGLPLPPPPPPPPGPPP 262 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/35 (40%), Positives = 16/35 (45%), Gaps = 4/35 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXK----XXPPPPPXXXGPPP 509 PPPPPP ++I PPPPP P P Sbjct: 251 PPPPPPPPGPPPREIVPGQTLLPPPPPPRPLQPSP 285 >06_03_0683 - 23490215-23490997 Length = 260 Score = 32.3 bits (70), Expect = 0.64 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K+PPPP + K PP P PPPP Sbjct: 5 KRPPPPAKAPEAPPETKPKISPPAKPIAAAPPPP 38 >05_07_0332 - 29332520-29332818,29333511-29333725,29334380-29334408, 29334956-29335045,29335120-29335155,29335222-29336553, 29337331-29337497,29337519-29337724,29337815-29338036, 29338332-29338381,29338754-29338870,29339471-29339551, 29339656-29339694,29340464-29340636,29340769-29340826, 29340934-29340987,29341066-29341613,29341695-29341755, 29342180-29342260,29342448-29342630,29342908-29343162, 29343304-29343423,29343497-29344901,29344988-29345085, 29345164-29345218,29345307-29345366,29346498-29346697 Length = 2077 Score = 32.3 bits (70), Expect = 0.64 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K P PPP PPPP Sbjct: 1931 PPPPPPPPPVEGK------PKPPPHAPPPPPP 1956 >12_02_0370 + 18139557-18140469,18140561-18140704,18140804-18140956, 18141032-18141147,18141231-18141398,18142110-18142334, 18142458-18142577 Length = 612 Score = 31.9 bits (69), Expect = 0.85 Identities = 12/30 (40%), Positives = 13/30 (43%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP + PPPP PPPP Sbjct: 70 PPPPQPQPEPQPAAPSQPPPPQEQPSPPPP 99 >12_01_0135 + 1042889-1044255,1045368-1045809 Length = 602 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPP Sbjct: 136 PPPPPPSHPALLPPDATAPPPPPTSVAALPPP 167 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPP PPPP Sbjct: 137 PPPPPSHPALLPPDATAPPPPPTSVAALPPPP 168 >11_01_0133 + 1121392-1122731,1123417-1123858 Length = 593 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPP Sbjct: 135 PPPPPPSHPALLPPDATAPPPPPTSVAALPPP 166 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPP PPPP Sbjct: 136 PPPPPSHPALLPPDATAPPPPPTSVAALPPPP 167 >03_05_1153 + 30787574-30787608,30787982-30788089,30788651-30788689, 30789181-30789184,30789496-30789580,30789609-30790321 Length = 327 Score = 31.9 bits (69), Expect = 0.85 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P K + PPPP P PP Sbjct: 174 PPPPAPEPEPEPPKKEEPQPPPPKEEEKPEPP 205 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PP P P K PPPP PPPP Sbjct: 212 EPPAPAPEPEPEPPKKEPPPPPPPKQEPCPPPP 244 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXP-PPPPXXXGPPPP 512 PPPPPP + K P PPPP P P Sbjct: 172 PPPPPPAPEPEPEPPKKEEPQPPPPKEEEKPEP 204 >03_02_0738 - 10824121-10825572 Length = 483 Score = 31.9 bits (69), Expect = 0.85 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP PPPP Sbjct: 79 PPPSPPSSSPPPLSF----PPPPPPPSSPPPP 106 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/29 (41%), Positives = 12/29 (41%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPP PPPPP PPP Sbjct: 78 PPPPSPPSSSPPPLSFPPPPPPPSSPPPP 106 >02_05_1057 + 33809982-33810366,33810436-33810687,33810727-33810926, 33811021-33811122 Length = 312 Score = 31.9 bits (69), Expect = 0.85 Identities = 17/38 (44%), Positives = 18/38 (47%), Gaps = 6/38 (15%) Frame = -2 Query: 511 GGGG------PXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG P GGGGG +F GGGGGG Sbjct: 17 GGGGTAGACCPGAAGGGGGGVGGVFIPGIIGGGGGGGG 54 >09_02_0603 - 11150739-11150746,11150791-11151340 Length = 185 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPPP PP P Sbjct: 62 PPPPPLGSFFVPPPQSRVPPPPPQLGVPPLP 92 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP PPP Sbjct: 44 PPPPPPGSTFVPLPQSGVPPPPPLGSFFVPPP 75 >09_02_0543 + 10427321-10428315,10428440-10429154 Length = 569 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P P P I + PPPPP PPPP Sbjct: 16 PRPTPAPQATPPPAIPESGPPPPPAPDMPPPP 47 >07_03_1636 + 28290642-28291574 Length = 310 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/33 (42%), Positives = 15/33 (45%), Gaps = 1/33 (3%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPP-PPPXXXGPPPP 512 PP PP + K PP PPP PPPP Sbjct: 163 PPSPPYVPPPPDAYLRKPSPPSPPPAKLSPPPP 195 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPP P P Sbjct: 151 PPPPPPQLFETAPPSPPYVPPPPDAYLRKPSP 182 >07_01_0862 - 7172083-7172931 Length = 282 Score = 31.5 bits (68), Expect = 1.1 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP KK+ PP PP Sbjct: 129 PPPPPPPPTAEEKKLLLFPPPLPP 152 >03_02_0455 - 8630543-8630893,8630994-8631068,8631149-8631223, 8631332-8631397,8631891-8631967,8632659-8633070 Length = 351 Score = 31.5 bits (68), Expect = 1.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 280 PPPPPPNAPMG---MPPRIPPPPVGGTQPPPP 308 >01_07_0021 - 40533864-40534583,40534779-40534814,40534909-40535048, 40535837-40535922,40536430-40536653,40536770-40536865, 40538766-40538833,40539945-40540055,40540799-40540955 Length = 545 Score = 31.5 bits (68), Expect = 1.1 Identities = 13/34 (38%), Positives = 14/34 (41%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 + PPPP P PPPP PPPP Sbjct: 416 QSPPPPLPSDAFEQPPPPPEHPPPPESTSPPPPP 449 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP PP P Sbjct: 430 PPPPPEHPPPPE---STSPPPPPTSDPPPVP 457 >09_02_0327 - 7284829-7284889,7284946-7286126 Length = 413 Score = 31.1 bits (67), Expect = 1.5 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P P P + I PPPPP PPPP Sbjct: 35 PCPSPASSYKERIIFGAHPPPPPPPPPPPPP 65 >07_01_0516 - 3850252-3852870 Length = 872 Score = 31.1 bits (67), Expect = 1.5 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PPP + PPPPP GP PP Sbjct: 16 PPQPPPT-----SRPLPPPPPPPPPAHGPSPP 42 >04_03_0018 - 9434088-9434141,9434211-9434282,9434968-9435062, 9435445-9435526,9435610-9435660,9435749-9435829, 9435965-9436006,9436117-9436215,9438130-9438201, 9438557-9438680,9438850-9439723,9440274-9440456, 9440941-9442741,9442825-9443049,9443117-9443814, 9444519-9444591 Length = 1541 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/24 (50%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP K PPPPP Sbjct: 986 PPPPPPLCDHAKKYTRIPLPPPPP 1009 >03_06_0771 - 36152554-36153215,36153320-36153818,36153924-36153956 Length = 397 Score = 31.1 bits (67), Expect = 1.5 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP + PPPPP Sbjct: 359 PPPPPPPPVYYSSYVMLDRPPPPP 382 Score = 29.9 bits (64), Expect = 3.4 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP + PPPPP Sbjct: 360 PPPPPPPVYYSSYVMLDRPPPPPP 383 >03_06_0399 - 33632811-33633107,33633236-33633385,33633705-33634029, 33635315-33635982,33636967-33637212,33637405-33637545, 33637807-33637856,33637943-33638060,33638304-33638910, 33639339-33639463,33639813-33639869,33639952-33640023, 33640100-33640232,33640305-33640428,33640522-33640576, 33640672-33641322 Length = 1272 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP ++ P PP PPPP Sbjct: 47 PPPSPPPPPPLDEETLAQFPSPPTNPSPPPPP 78 >03_01_0178 + 1437263-1438017,1438754-1438858,1438950-1439072, 1439908-1440078,1440163-1440292,1440372-1440581, 1440675-1440773 Length = 530 Score = 31.1 bits (67), Expect = 1.5 Identities = 12/30 (40%), Positives = 14/30 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 PP PPP ++ K PPPP PP Sbjct: 126 PPQPPPPAAQHGVQLAKAETPPPPQRTQPP 155 >02_04_0400 - 22608519-22608844,22609044-22609122 Length = 134 Score = 31.1 bits (67), Expect = 1.5 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGGFFXXP 401 GGGG GGGGG GGGGGG + P Sbjct: 60 GGGGRGGGGGGGGGGGGGGGGGGGGGGGGGGGGYYPP 96 Score = 29.1 bits (62), Expect = 6.0 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = -2 Query: 526 KKXXXGGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 K+ GGGG GGGGG GGGGGG Sbjct: 30 KQGCGGGGGGGGGGGGGGGGG----GGGGGGGGGGGG 62 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG GGGGG GGGGGG Sbjct: 51 GGGGGGGGGGGGGRGGGGGGGGGGGGGGGGGG 82 >10_06_0008 - 9533424-9533475,9533526-9535344,9535599-9536364, 9551969-9552097 Length = 921 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 474 PPPPPXXXGPPPP 512 PPPPP PPPP Sbjct: 338 PPPPPPPPPPPPP 350 Score = 21.8 bits (44), Expect(2) = 1.8 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 402 GXXKKPPPPPP 434 G PPPPPP Sbjct: 336 GNPPPPPPPPP 346 >01_07_0188 - 41866689-41866763,41866889-41867155,41867277-41867722, 41867945-41868033,41868279-41868368,41868661-41868739, 41868979-41869042,41869597-41869684,41869776-41869836, 41869906-41869969,41870134-41870188,41870275-41870346, 41870469-41870551,41870629-41870724,41871279-41871383, 41872159-41872227,41872470-41872561,41872667-41872886 Length = 704 Score = 27.5 bits (58), Expect(2) = 1.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 474 PPPPPXXXGPPPP 512 PPPPP PPPP Sbjct: 9 PPPPPPPQHPPPP 21 Score = 21.8 bits (44), Expect(2) = 1.8 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +3 Query: 411 KKPPPPPP 434 ++PPPPPP Sbjct: 6 QQPPPPPP 13 >01_06_0642 + 30811708-30811768,30812256-30812305,30812455-30812926, 30813237-30813596,30813694-30814101,30814383-30814453, 30814553-30814629,30814741-30814888,30815878-30816039, 30816119-30816304 Length = 664 Score = 28.3 bits (60), Expect(2) = 1.8 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 474 PPPPPXXXGPPPP 512 PPPPP PPPP Sbjct: 205 PPPPPRIASPPPP 217 Score = 21.0 bits (42), Expect(2) = 1.8 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +3 Query: 417 PPPPPP 434 PPPPPP Sbjct: 204 PPPPPP 209 >09_01_0037 - 604001-604957 Length = 318 Score = 27.9 bits (59), Expect(2) = 1.9 Identities = 11/31 (35%), Positives = 12/31 (38%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP + PP P PPPP Sbjct: 232 PPPPSQMPPPTPSCVRQEPPQMPFQLQPPPP 262 Score = 21.4 bits (43), Expect(2) = 1.9 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 402 GXXKKPPPPPP 434 G PPPPPP Sbjct: 188 GVVVPPPPPPP 198 >12_01_0033 - 272848-272943,274026-274169,274264-274375,274521-274702, 274781-274912,275038-276330,279841-280545,280649-280695, 280787-280865 Length = 929 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PP PPPPP G PPP Sbjct: 597 PRPPPAPSATANTASALPPPPPRPPGAPPP 626 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPP PPPP PPPP Sbjct: 597 PRPPPAPSATANTASALPPPPPRPPGAPPPP 627 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP G PPP Sbjct: 614 PPPPP------RPPGAPPPPPPPGKPGGPPP 638 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP P PP PP PPPP Sbjct: 599 PPPAPSATANTASALPPPPPRPPGAPPPPPP 629 >11_06_0610 - 25449085-25453284 Length = 1399 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +K PPPP I PPPP PPPP Sbjct: 1149 EKSPPPPAPVILPPPPIKS--PPPPAPVISPPPP 1180 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPP P PPPP PPPP Sbjct: 1182 KSPPPPAPVILPPPPV---KSPPPPAPVISPPPP 1212 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/34 (41%), Positives = 14/34 (41%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PPPP P PPPP PPPP Sbjct: 1214 KSPPPPAPVILPPPPV---KSPPPPAPVISPPPP 1244 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 K PPPP P K PPP P PPP Sbjct: 1166 KSPPPPAPVISPPPP--VKSPPPPAPVILPPPP 1196 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/33 (42%), Positives = 14/33 (42%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 K PPPP P K PPP P PPP Sbjct: 1198 KSPPPPAPVISPPPP--VKSPPPPAPVILPPPP 1228 >07_03_1147 + 24349811-24350161,24351031-24351366,24353260-24353376, 24353585-24353647,24354066-24354139,24354216-24354306, 24354791-24354850,24355270-24355462,24356242-24356522, 24357435-24357536,24357664-24357774,24358410-24358475, 24358562-24358660,24358757-24358788,24359171-24359274, 24359380-24359507,24359625-24359756,24360051-24360359, 24360887-24361071,24361161-24361263,24361407-24361552, 24361748-24361827,24361901-24362103 Length = 1121 Score = 30.7 bits (66), Expect = 2.0 Identities = 14/35 (40%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPP P + PPPPP P PP F Sbjct: 47 PPPPQPTLPPPPPRTLPPPPPPPP----PQPPVGF 77 >06_02_0119 + 12040476-12041273,12042767-12042834,12042931-12042979 Length = 304 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP K P P PPPP Sbjct: 57 PPPPPPQPAKEPPPPTKPKHPKPKQQQHPPPP 88 >03_05_0524 - 25181432-25181483,25181565-25181691,25181776-25181826, 25182159-25182314,25182405-25182905,25182999-25183713, 25183797-25183867,25183974-25184103,25185706-25186167 Length = 754 Score = 30.7 bits (66), Expect = 2.0 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP PPPPP P PP Sbjct: 359 PPPLPPATVEPVISAPMVEPPPPPAMITPLPP 390 >03_02_0155 - 5974118-5974173,5974242-5974314,5974393-5974500, 5975189-5976914,5977065-5977620,5978008-5978485 Length = 998 Score = 30.7 bits (66), Expect = 2.0 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPP + PPPP PPP Sbjct: 70 PPPPPRPPSFAPENALPPSSPPPPSPPPPPP 100 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P + PPPP PPPP Sbjct: 71 PPPPRPPSFAPENALPPSSPPPPS---PPPPP 99 >03_06_0289 - 32870581-32871238,32871271-32871275 Length = 220 Score = 28.3 bits (60), Expect(2) = 2.0 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 474 PPPPPXXXGPPPP 512 PPPPP PPPP Sbjct: 206 PPPPPVHYAPPPP 218 Score = 21.0 bits (42), Expect(2) = 2.0 Identities = 6/6 (100%), Positives = 6/6 (100%) Frame = +3 Query: 417 PPPPPP 434 PPPPPP Sbjct: 204 PPPPPP 209 >03_02_0045 - 5251234-5251305,5251362-5251419,5252256-5252539, 5252836-5253019,5253564-5253814,5253921-5254024, 5254143-5254281 Length = 363 Score = 27.5 bits (58), Expect(2) = 2.5 Identities = 9/13 (69%), Positives = 9/13 (69%) Frame = +3 Query: 474 PPPPPXXXGPPPP 512 PPPPP PPPP Sbjct: 34 PPPPPSAATPPPP 46 Score = 21.4 bits (43), Expect(2) = 2.5 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +3 Query: 414 KPPPPPP 434 +PPPPPP Sbjct: 32 QPPPPPP 38 >12_01_0753 + 6810239-6810661,6812495-6812584,6812724-6812894, 6813015-6813109,6813538-6813658,6813884-6814015 Length = 343 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXP---PPPPXXXGPPPP 512 PPPPPP P PPP PPPP Sbjct: 10 PPPPPPMDEDASAGAHHAFPGPAPPPSPEGAPPPP 44 >11_01_0035 - 256087-256185,256287-256430,256521-256632,256777-256958, 257038-257169,257297-258589,259133-259837,260465-260549, 260604-260650,260810-260900,261838-262101,262195-262309, 262455-262570,262713-262847,262969-263036,263292-263411 Length = 1235 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPP PPPP PPPP Sbjct: 902 PRPPPAPSATANTASALSPPPPRPPGAPPPP 932 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP P PP PP PPPP Sbjct: 904 PPPAPSATANTASALSPPPPRPPGAPPPPPP 934 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPP GPPPP Sbjct: 920 PPPPRPPGAPPP-------PPPPGKPGGPPPP 944 >10_08_0608 + 19184722-19185224,19185331-19185410,19186048-19186235, 19187021-19187927,19188015-19188142,19189270-19189356, 19189422-19189472,19189582-19189668,19189746-19189873, 19190469-19190608,19190721-19190882,19190964-19192733, 19192807-19192922,19193077-19193227,19193243-19193371, 19193598-19194139 Length = 1722 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 4/34 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXK----KIXKXXPPPPPXXXGPP 506 PPPPPP + PPPPP GPP Sbjct: 33 PPPPPPLEPAPPSTPQLRGEASPPPPPPPPVGPP 66 >09_04_0506 - 18188785-18190599 Length = 604 Score = 30.3 bits (65), Expect = 2.6 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP ++ PPP PPPP Sbjct: 50 PPPQPPPPPQQQQQPPPISQQPPPLQAPPPPP 81 >09_02_0369 - 8012470-8013120 Length = 216 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/41 (36%), Positives = 17/41 (41%), Gaps = 5/41 (12%) Frame = +3 Query: 414 KPPPPPPXXXXXXK-----KIXKXXPPPPPXXXGPPPPXXF 521 KPPPPPP K + PPPP PPP + Sbjct: 38 KPPPPPPHDDPPLKPPPQQQFITAQPPPPDEPPLKPPPSFY 78 >08_01_0539 + 4679392-4681282,4682060-4682104,4682403-4683560, 4683834-4684204,4684290-4684835,4684927-4685027, 4685117-4685933,4686025-4686213,4686313-4686384, 4686477-4686587,4686647-4686652,4686694-4686794, 4687714-4687813,4687891-4687986,4688157-4688273, 4688367-4688492,4688566-4688619,4688745-4688992, 4689087-4689195,4689284-4689583,4689799-4689963 Length = 2240 Score = 30.3 bits (65), Expect = 2.6 Identities = 13/31 (41%), Positives = 14/31 (45%), Gaps = 1/31 (3%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPP-PXXXGPP 506 PPPPPP + PPPP P G P Sbjct: 434 PPPPPPPPPPLPPNMPPPLPPPPEPELNGAP 464 >07_03_0792 - 21541301-21542143,21542426-21542661,21543177-21543373, 21543459-21544173,21544250-21544892,21545970-21546139, 21546442-21546943 Length = 1101 Score = 30.3 bits (65), Expect = 2.6 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP P K PPPPP GP PP Sbjct: 585 PPPEPSPPPAPK---AAPPPPPPKSTGPGPP 612 >06_01_0931 + 7192519-7194075 Length = 518 Score = 30.3 bits (65), Expect = 2.6 Identities = 11/31 (35%), Positives = 14/31 (45%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P P +++ PPPPP PPPP Sbjct: 115 PLSPDTARDVVRRLMPSPPPPPPRSQAPPPP 145 >04_03_1022 - 21778315-21779007 Length = 230 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = +3 Query: 414 KPPPPPPXXXXXX--KKIXKXXPPPPPXXXGPPPP 512 +PPPPPP PPPPP PPPP Sbjct: 15 EPPPPPPATRARPPCSSAHLLPPPPPPP---PPPP 46 >04_01_0001 + 48461-48625,49314-50491,50620-50816,50896-52076 Length = 906 Score = 30.3 bits (65), Expect = 2.6 Identities = 16/44 (36%), Positives = 17/44 (38%), Gaps = 7/44 (15%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPP-------XXXGPPPP 512 G PPPPPP + P PPP GPPPP Sbjct: 344 GAGSGPPPPPPPAAPAAPRPPGPGPGPPPPPGAAGRGGGGPPPP 387 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPX---XXGPPPP 512 PPPP P PPPPP PPPP Sbjct: 302 PPPPHPLPPGAGAGAGTGAPPPPPAHPAAPAPPPP 336 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P PPPP P PP Sbjct: 333 PPPPAPSPSAAGAGSGPPPPPPPAAPAAPRPP 364 >03_05_0067 - 20460206-20460703,20461255-20461530 Length = 257 Score = 30.3 bits (65), Expect = 2.6 Identities = 10/17 (58%), Positives = 11/17 (64%) Frame = +3 Query: 474 PPPPPXXXGPPPPXXFF 524 PPPP GPPPP +F Sbjct: 5 PPPPQWAMGPPPPPQYF 21 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/31 (38%), Positives = 12/31 (38%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPP PPP Sbjct: 25 PPPPPPQYFQGAHPPAAMWGQPPPPQAAPPP 55 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP PPPP PP P Sbjct: 26 PPPPPQYFQGAHPPAAMWGQPPPPQAAPPPAP 57 >02_04_0567 - 23914330-23914461,23915016-23915136,23915954-23916048, 23916131-23916301,23917291-23917380,23917636-23918139 Length = 370 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 38 PPPPPP-------------PPPPPPPPPPPPP 56 >01_06_1670 - 39007402-39008229,39008320-39008567,39009159-39009364, 39009454-39011054 Length = 960 Score = 30.3 bits (65), Expect = 2.6 Identities = 15/37 (40%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PP P Sbjct: 352 GQPPAPPPPPP--------FAPTLPPPPPPRRKPPSP 380 >03_03_0038 + 13984525-13984917,13985351-13985429,13985535-13985628, 13985712-13985844 Length = 232 Score = 24.6 bits (51), Expect(2) = 2.6 Identities = 8/19 (42%), Positives = 11/19 (57%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXK 467 K PPPPPP K++ + Sbjct: 79 KPPPPPPPPKQEKAKRVVR 97 Score = 24.2 bits (50), Expect(2) = 2.6 Identities = 8/11 (72%), Positives = 8/11 (72%) Frame = +3 Query: 402 GXXKKPPPPPP 434 G K PPPPPP Sbjct: 34 GEAKPPPPPPP 44 >12_02_1036 - 25587313-25587890,25589209-25589272,25589356-25589448, 25589533-25589683,25590474-25590539,25590594-25590907 Length = 421 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/42 (35%), Positives = 17/42 (40%), Gaps = 9/42 (21%) Frame = +3 Query: 411 KKPPPPPPXXXXXXK---------KIXKXXPPPPPXXXGPPP 509 K PPPPPP ++ PPPPP PPP Sbjct: 9 KPPPPPPPQLEASGSDPDDPLLRDRVVVIAPPPPPPPPPPPP 50 >12_01_0838 - 7830944-7831444 Length = 166 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG GGG G + GGGGGG Sbjct: 114 GGGGGGGGGGGSGQGSGSGYGYGYGKGGGGGG 145 >11_06_0453 + 23781803-23781814,23782700-23782781,23783334-23784160 Length = 306 Score = 29.9 bits (64), Expect = 3.4 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPP K K PPPPP PPP Sbjct: 97 PPPVNTGKKKWKKDKRKEIPPPPPLAETPPP 127 >07_03_1573 + 27829967-27830338,27830821-27831510,27831594-27831781, 27832286-27832318,27832364-27832605,27833178-27833320, 27833649-27833825,27834104-27834256,27834639-27834694, 27834998-27835157,27835301-27835348 Length = 753 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP GP P Sbjct: 36 PPPPPPR---------RRTPPPPPPGSGPGP 57 >07_03_0600 + 19866757-19867218,19867920-19868429 Length = 323 Score = 29.9 bits (64), Expect = 3.4 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 474 PPPPPXXXGPPPPXXF 521 PPPPP PPPP F Sbjct: 74 PPPPPPQYAPPPPQQF 89 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/36 (36%), Positives = 16/36 (44%), Gaps = 3/36 (8%) Frame = +3 Query: 414 KPPPPPPXXXXXXKK---IXKXXPPPPPXXXGPPPP 512 +PPPPPP + + PPP PPPP Sbjct: 73 QPPPPPPQYAPPPPQQFQLPHQQYAPPPQHYAPPPP 108 >05_07_0125 + 27861368-27862282 Length = 304 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = -2 Query: 508 GGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGG GGGGG + GGGGGG Sbjct: 222 GGGDGYRGGGGGGGGDGYRGGDSYRGGGGGG 252 >04_04_0760 - 27837170-27837328,27837441-27837504,27837812-27838160, 27838906-27838960,27839489-27839821 Length = 319 Score = 29.9 bits (64), Expect = 3.4 Identities = 12/30 (40%), Positives = 12/30 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 PPPPPP K PPPP P Sbjct: 10 PPPPPPPSESTPTSDPKPPPPPPTSSTAAP 39 Score = 29.5 bits (63), Expect = 4.5 Identities = 11/24 (45%), Positives = 11/24 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP PPPPP Sbjct: 9 PPPPPPPPSESTPTSDPKPPPPPP 32 >03_05_0919 - 28792790-28792915,28793090-28793155,28794345-28794530, 28794604-28795141,28795290-28795363 Length = 329 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG GGGG + GGGGGG Sbjct: 156 GGGGDVGGDGGGGGDGNVGGGGGGGGGGGGGG 187 >01_06_0090 + 26358051-26359157,26359582-26359701,26359968-26360099, 26360194-26360375,26360488-26360602,26362001-26362135, 26362261-26362395 Length = 641 Score = 29.9 bits (64), Expect = 3.4 Identities = 14/34 (41%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 K PP PPP + PPPP PPPP Sbjct: 268 KLPPIPPPPPMPALSVCGRAAAPPPPP---PPPP 298 >01_03_0005 + 11568545-11569119,11569179-11569191 Length = 195 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/32 (46%), Positives = 17/32 (53%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG GGGG I++ GGGGGG Sbjct: 99 GGGGGSSTGGGG-----IYYPPPTGGGGGGGG 125 >01_01_0446 + 3321832-3322232,3322398-3322455,3322810-3323748, 3324504-3324654,3324740-3324818,3325826-3325934 Length = 578 Score = 29.9 bits (64), Expect = 3.4 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGGF 413 GGGG GGGGG + GGGGGG+ Sbjct: 72 GGGGGGYGGGGGG------YGGGGRGGGGGGGY 98 >12_02_0299 - 17051570-17052474,17053542-17053755 Length = 372 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/34 (38%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKI--XKXXPPPPPXXXGPPPP 512 PPPPPP ++ PP P PPPP Sbjct: 290 PPPPPPAFPFPFPQLPPLPHFPPLPSFYPSPPPP 323 >11_06_0188 + 21036465-21036627,21036735-21036883,21037369-21037484, 21037939-21038101 Length = 196 Score = 29.5 bits (63), Expect = 4.5 Identities = 16/33 (48%), Positives = 16/33 (48%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGGF 413 GGGG GGGGG F GGGGGF Sbjct: 13 GGGGGGRFGGGGGRGGR-FGGGGRGGRGGGGGF 44 >11_01_0359 - 2731522-2732346 Length = 274 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 52 PPPPPPHAYHHHH-----YPPPPPPHHHPYPP 78 >06_02_0175 - 12624608-12625297 Length = 229 Score = 29.5 bits (63), Expect = 4.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG GGGGG GGGGGG Sbjct: 94 GGGGSSGGGGGGGGGGGGGGGGGGGGGGGGGG 125 >06_01_0486 - 3455030-3455770 Length = 246 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/35 (37%), Positives = 15/35 (42%), Gaps = 2/35 (5%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGP--PPP 512 +PPP PP + PPP P P PPP Sbjct: 85 RPPPTPPYVPSPPPYVPPYIPPPTPPYVPPYIPPP 119 >04_03_0800 - 19820886-19821421,19822476-19822563,19822871-19822888 Length = 213 Score = 29.5 bits (63), Expect = 4.5 Identities = 12/28 (42%), Positives = 13/28 (46%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPP 485 G KPPPPPP + PPPP Sbjct: 168 GASCKPPPPPPPAIWPPQPSFYYYPPPP 195 >03_06_0427 - 33857008-33857137,33857224-33857258,33857966-33858046, 33858213-33858338,33858410-33858568,33858797-33858934, 33859084-33859155,33859359-33860273 Length = 551 Score = 29.5 bits (63), Expect = 4.5 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG GGGGG GGGGGG Sbjct: 47 GGGGSGGGGGGGGGGGGGGGSGGGCGGGGGGG 78 >02_04_0005 - 18843061-18843201,18843309-18843440,18844457-18845315, 18845884-18845973,18846748-18846869,18846950-18847049, 18847151-18847205,18847275-18847365,18847453-18847572, 18847681-18847780,18847890-18848018,18848099-18848201, 18848670-18848743,18848848-18848933,18849297-18849358, 18849454-18849541,18849937-18850029 Length = 814 Score = 29.5 bits (63), Expect = 4.5 Identities = 13/33 (39%), Positives = 15/33 (45%), Gaps = 2/33 (6%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP--XXXGPPP 509 PPPPPP + + PPP P PPP Sbjct: 671 PPPPPPSSTPPVEPVAVFPPPPSPACGVYYPPP 703 >01_01_0083 + 631196-631675 Length = 159 Score = 29.5 bits (63), Expect = 4.5 Identities = 14/29 (48%), Positives = 16/29 (55%) Frame = -2 Query: 499 PXXXGGGGGXXXIIFFXXXXXXGGGGGGF 413 P GGGGG I ++ GGGGGGF Sbjct: 78 PPPQGGGGGY--IPYYQPPAGGGGGGGGF 104 >01_06_0046 + 25943183-25943590 Length = 135 Score = 25.8 bits (54), Expect(2) = 4.7 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 474 PPPPPXXXGPPPPXXFF 524 P PPP PPPP ++ Sbjct: 48 PSPPPPALPPPPPYYYY 64 Score = 22.2 bits (45), Expect(2) = 4.7 Identities = 6/14 (42%), Positives = 10/14 (71%) Frame = +3 Query: 636 FFFFSPPPPXXXGG 677 ++++SPPPP G Sbjct: 61 YYYYSPPPPAYYPG 74 >02_04_0382 - 22501041-22501279,22501717-22501810 Length = 110 Score = 24.2 bits (50), Expect(2) = 4.8 Identities = 10/35 (28%), Positives = 12/35 (34%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPP P PP P PPP ++ Sbjct: 47 PPPSPEYYDPPPSPDYYDPPHSPDYYDPPPSPDYY 81 Score = 23.8 bits (49), Expect(2) = 4.8 Identities = 8/18 (44%), Positives = 10/18 (55%) Frame = +3 Query: 642 FFSPPPPXXXGGGXGXXK 695 ++ PPP GGG G K Sbjct: 80 YYDPPPSPYYGGGGGYGK 97 >01_01_0796 + 6190931-6192745 Length = 604 Score = 26.2 bits (55), Expect(2) = 5.2 Identities = 10/23 (43%), Positives = 12/23 (52%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPP 482 +PPPPPP I + PPP Sbjct: 236 QPPPPPPPAAGGSLWIPELPPPP 258 Score = 21.4 bits (43), Expect(2) = 5.2 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 402 GXXKKPPPPPP 434 G PPPPPP Sbjct: 189 GSSVPPPPPPP 199 >12_02_1219 + 27096477-27096590,27096704-27097078 Length = 162 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/33 (45%), Positives = 17/33 (51%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGGF 413 GGGG GGGGG + GGGGGG+ Sbjct: 93 GGGGYGQRGGGGG-----YGGGGGYGGGGGGGY 120 >11_01_0066 - 536281-537196,537397-537452 Length = 323 Score = 29.1 bits (62), Expect = 6.0 Identities = 11/31 (35%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PP + + PPPP PP P Sbjct: 197 PPTPPTIARPPRPLPPASPPPPSIATPPPSP 227 >10_08_0630 - 19410852-19411235,19411370-19412257,19412440-19412941, 19413662-19414135,19414982-19415040,19415468-19415629 Length = 822 Score = 29.1 bits (62), Expect = 6.0 Identities = 10/23 (43%), Positives = 11/23 (47%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPP 488 PPPPP + PPPPP Sbjct: 431 PPPPPSHPTPITSVAPAPPPPPP 453 >08_02_1084 - 24232968-24234779 Length = 603 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/37 (40%), Positives = 17/37 (45%), Gaps = 4/37 (10%) Frame = +3 Query: 411 KKPP----PPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 K+PP PPPP + PPPPP PPP Sbjct: 71 KQPPSQQLPPPPQQQQPPPQ--HSLPPPPPLPQAPPP 105 >08_01_0202 - 1638978-1639571 Length = 197 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/32 (43%), Positives = 16/32 (50%) Frame = -2 Query: 508 GGGPXXXGGGGGXXXIIFFXXXXXXGGGGGGF 413 GGG GGGGG + GGGGGG+ Sbjct: 85 GGGDRGYGGGGGGGR---YGGDRGYGGGGGGY 113 >07_03_0329 + 16840051-16840917,16840999-16841342,16841444-16841574, 16841671-16841792,16841877-16841983,16842104-16842236, 16842342-16842458,16842560-16842667,16842716-16842742, 16842759-16842830,16843462-16843584,16843671-16843833, 16844140-16844264,16844355-16844489,16844574-16844677, 16844772-16844834,16844930-16844993,16845186-16845318, 16845414-16845487,16845603-16845697,16845799-16845830, 16846201-16846355 Length = 1097 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = -2 Query: 508 GGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GG GGGGG ++ GGGGGG Sbjct: 53 GGRGGGYGGGGGGGGPPYYGGGGGGGGGGGG 83 >07_03_0177 - 14770777-14772045 Length = 422 Score = 29.1 bits (62), Expect = 6.0 Identities = 17/36 (47%), Positives = 17/36 (47%), Gaps = 3/36 (8%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGG---GGGF 413 GGGG GGGGG F GGG GGGF Sbjct: 88 GGGGGLGGGGGGGLGGGGGFGKGGGVGGGFGKGGGF 123 >07_01_0753 - 5799733-5799741,5799938-5800642 Length = 237 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/36 (36%), Positives = 14/36 (38%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 +P PPP PPPPP PPP F Sbjct: 23 QPLLPPPNQPYYAFPAAAYAPPPPPPPPPPPPTLVF 58 >06_03_0790 - 24636805-24637770 Length = 321 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG GGGGG GGGGGG Sbjct: 82 GGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG 113 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG GGGGG GGGGGG Sbjct: 102 GGGGGGGGGGGGGGGGGGGRGGGGGGGGGGGG 133 Score = 29.1 bits (62), Expect = 6.0 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG GGGGG + GGGGGG Sbjct: 238 GGGGWESSGGGGGRGDV---SGAGGGGGGGGG 266 >06_03_0425 - 20659298-20659634,20659964-20660075,20660161-20660272 Length = 186 Score = 29.1 bits (62), Expect = 6.0 Identities = 17/42 (40%), Positives = 19/42 (45%) Frame = -2 Query: 526 KKXXXGGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGGFFXXP 401 +K GGGG GGGGG GGGGGG+ P Sbjct: 35 EKKFGGGGGGYGGGGGGG----------YGGGGGGGGYSPSP 66 >05_07_0100 + 27679280-27680320 Length = 346 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PP P PPPP Sbjct: 147 PVPPPPYFAMPIHPSAVRKPPSPSPSPSPPPP 178 >05_01_0380 + 2978256-2979284 Length = 342 Score = 29.1 bits (62), Expect = 6.0 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 474 PPPPPXXXGPPPPXXF 521 PPPPP PPPP F Sbjct: 29 PPPPPPPPPPPPPRPF 44 >05_01_0004 - 34967-35149,35340-35501,36078-36225,36309-36385, 36507-36577,36850-37263,37518-38268 Length = 601 Score = 29.1 bits (62), Expect = 6.0 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP P + PPPPP PPPP Sbjct: 59 PPPASPPLPSATPPLAASPPPPPP----PPPP 86 >04_04_0057 + 22410167-22411330 Length = 387 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + P P PPPP Sbjct: 183 PPPPPPPAAAAASPSPERSPRCQPSPPPPPPP 214 >03_02_0149 + 5933134-5933207,5935039-5935267,5935370-5935468, 5935582-5935616,5935694-5935769,5936552-5936662, 5937001-5937087,5937302-5937395,5937489-5937606, 5938047-5938542,5939263-5939298,5940047-5940578, 5940668-5940792 Length = 703 Score = 29.1 bits (62), Expect = 6.0 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 542 PPPPPP---------PRNMLPPPPKSMPPPPP 564 Score = 28.7 bits (61), Expect = 7.9 Identities = 10/16 (62%), Positives = 10/16 (62%) Frame = +3 Query: 465 KXXPPPPPXXXGPPPP 512 K PPPPP PPPP Sbjct: 589 KSMPPPPPKSMPPPPP 604 >01_01_0715 - 5542648-5543219,5543352-5543544 Length = 254 Score = 29.1 bits (62), Expect = 6.0 Identities = 12/33 (36%), Positives = 13/33 (39%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +P PPPP P P P G PPP Sbjct: 158 RPSPPPPAAGTNGTARAPSPPVPAPAPAGSPPP 190 >03_03_0278 - 16126803-16129049 Length = 748 Score = 25.0 bits (52), Expect(2) = 6.6 Identities = 8/13 (61%), Positives = 8/13 (61%) Frame = +3 Query: 474 PPPPPXXXGPPPP 512 PPPPP P PP Sbjct: 188 PPPPPPRQAPAPP 200 Score = 22.2 bits (45), Expect(2) = 6.6 Identities = 6/8 (75%), Positives = 8/8 (100%) Frame = +3 Query: 411 KKPPPPPP 434 ++PPPPPP Sbjct: 184 QRPPPPPP 191 >05_07_0200 - 28368890-28369021,28369169-28369303,28369918-28369947, 28370019-28370093,28370222-28370333,28370440-28370621, 28370723-28370854,28372193-28373479 Length = 694 Score = 25.4 bits (53), Expect(2) = 6.6 Identities = 9/16 (56%), Positives = 9/16 (56%) Frame = +3 Query: 474 PPPPPXXXGPPPPXXF 521 PPPPP PP P F Sbjct: 240 PPPPPPPLPPPMPATF 255 Score = 21.8 bits (44), Expect(2) = 6.6 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +3 Query: 414 KPPPPPP 434 +PPPPPP Sbjct: 237 RPPPPPP 243 >03_06_0758 - 36052261-36052301,36052463-36052697,36052895-36052966, 36056477-36056567,36056650-36056872,36056964-36057300, 36057406-36057588 Length = 393 Score = 25.4 bits (53), Expect(2) = 7.0 Identities = 8/12 (66%), Positives = 8/12 (66%) Frame = +3 Query: 474 PPPPPXXXGPPP 509 PPPPP PPP Sbjct: 145 PPPPPMAVAPPP 156 Score = 21.8 bits (44), Expect(2) = 7.0 Identities = 7/11 (63%), Positives = 7/11 (63%) Frame = +3 Query: 402 GXXKKPPPPPP 434 G PPPPPP Sbjct: 138 GATAPPPPPPP 148 >11_06_0016 - 19284810-19284926,19285527-19286879 Length = 489 Score = 28.7 bits (61), Expect = 7.9 Identities = 12/32 (37%), Positives = 12/32 (37%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PP PPP P PPPP Sbjct: 64 PPMPPASAAAGDGAAPDQEPPPSPPPPPPPPP 95 >11_01_0621 - 4981070-4981136,4982906-4983825 Length = 328 Score = 28.7 bits (61), Expect = 7.9 Identities = 10/20 (50%), Positives = 12/20 (60%) Frame = +3 Query: 453 KKIXKXXPPPPPXXXGPPPP 512 + I + PPPPP PPPP Sbjct: 121 RDIVESPPPPPPHPLPPPPP 140 >10_08_0738 - 20212220-20212282,20212387-20212593,20212690-20212819, 20212919-20213089,20213311-20213433,20213517-20213618, 20214123-20214880 Length = 517 Score = 28.7 bits (61), Expect = 7.9 Identities = 13/30 (43%), Positives = 14/30 (46%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP K + P PPP PPPP Sbjct: 7 PPPPSRPVVAKSPPRRQPHPPPP---PPPP 33 >09_04_0684 - 19442335-19442990,19443774-19443839,19443935-19444032, 19444787-19445157 Length = 396 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/35 (40%), Positives = 14/35 (40%), Gaps = 5/35 (14%) Frame = +3 Query: 417 PPPP-----PPXXXXXXKKIXKXXPPPPPXXXGPP 506 PPPP PP PPPPP GPP Sbjct: 248 PPPPGQGPVPPRDAPPMHHAQGNVPPPPPPNAGPP 282 >07_03_1136 + 24218601-24218734,24218769-24219906 Length = 423 Score = 28.7 bits (61), Expect = 7.9 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGG 419 GGGG GGGGG GGGGG Sbjct: 296 GGGGGGGGGGGGGHGAPELGFSGGGGGGGGG 326 >07_03_0559 + 19475893-19476783 Length = 296 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGGGGG 416 GGGG GGGGG F G GGGG Sbjct: 68 GGGGGFRGGGGGGLGGGGGFGGGGGGGLGGGG 99 >07_01_0789 - 6150257-6151046,6151167-6151390,6151816-6151991, 6152778-6153801 Length = 737 Score = 28.7 bits (61), Expect = 7.9 Identities = 10/20 (50%), Positives = 11/20 (55%) Frame = +3 Query: 453 KKIXKXXPPPPPXXXGPPPP 512 K + PPPPP PPPP Sbjct: 90 KPVLAILPPPPPELPPPPPP 109 >06_03_0310 - 19453047-19453160,19453240-19453338,19453441-19453513, 19453598-19453708,19453795-19453956,19454064-19454340, 19454542-19455160,19455256-19455471 Length = 556 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/32 (34%), Positives = 12/32 (37%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PP + PPPP P PP Sbjct: 153 PPAPPSPPQDPAPSLPHAPAPPPPQAPAPTPP 184 >05_07_0031 - 27183252-27183317,27183542-27184282 Length = 268 Score = 28.7 bits (61), Expect = 7.9 Identities = 11/32 (34%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + + P PPPP Sbjct: 123 PPPPPPTTTTKPESLPAEADSEPELKAPPPPP 154 >03_05_0161 + 21400580-21401695 Length = 371 Score = 28.7 bits (61), Expect = 7.9 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXG 500 G PPPPPP + + PPPPP G Sbjct: 19 GGTTTPPPPPPAQQQQQQPL----PPPPPQEQG 47 >02_01_0713 - 5332145-5332351,5332675-5332893,5334347-5334559, 5334637-5334730,5334860-5335020,5335114-5335315, 5335619-5335784,5336208-5336286 Length = 446 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGG--GGGF 413 GGGG GGGG + GGG GGGF Sbjct: 403 GGGGGFNPFGGGGQQYTFHYDGGFHGGGGFPGGGF 437 >02_01_0275 - 1828300-1828344,1828396-1828531,1828623-1829317 Length = 291 Score = 28.7 bits (61), Expect = 7.9 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 2/39 (5%) Frame = +3 Query: 402 GXXKKP--PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G KP PPPPP KK PP PP P PP Sbjct: 103 GRTAKPYRPPPPP-----RKKPQFQPPPQPPRAWDPSPP 136 >01_07_0380 + 43181564-43181639,43182053-43182218,43182494-43182695, 43182789-43182949,43183079-43183172,43183250-43183462, 43184917-43185135,43185458-43185661 Length = 444 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/35 (42%), Positives = 16/35 (45%), Gaps = 2/35 (5%) Frame = -2 Query: 511 GGGGPXXXGGGGGXXXIIFFXXXXXXGGG--GGGF 413 GGGG GGGG + GGG GGGF Sbjct: 401 GGGGGFNPFGGGGQQYTFHYDGGFYGGGGFPGGGF 435 >01_05_0562 - 23307526-23307875,23308149-23308452,23308543-23308647 Length = 252 Score = 28.7 bits (61), Expect = 7.9 Identities = 15/37 (40%), Positives = 15/37 (40%), Gaps = 1/37 (2%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXK-KIXKXXPPPPPXXXGPPP 509 G KP P PP K K K P P P GP P Sbjct: 160 GPKPKPKPSPPKPKPGPKPKPPKPGPKPKPPKPGPKP 196 >12_02_0072 + 13218669-13218706,13218715-13218781,13220400-13220471, 13222107-13222182,13222309-13222943 Length = 295 Score = 25.0 bits (52), Expect(2) = 9.3 Identities = 8/17 (47%), Positives = 10/17 (58%) Frame = +3 Query: 474 PPPPPXXXGPPPPXXFF 524 PPPPP PPP ++ Sbjct: 263 PPPPPAYPYVPPPQYYY 279 Score = 21.8 bits (44), Expect(2) = 9.3 Identities = 6/7 (85%), Positives = 7/7 (100%) Frame = +3 Query: 414 KPPPPPP 434 +PPPPPP Sbjct: 261 RPPPPPP 267 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,275,405 Number of Sequences: 37544 Number of extensions: 421987 Number of successful extensions: 9245 Number of sequences better than 10.0: 132 Number of HSP's better than 10.0 without gapping: 2476 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6459 length of database: 14,793,348 effective HSP length: 82 effective length of database: 11,714,740 effective search space used: 3010688180 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -