BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_E17 (1019 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. 41 0.008 BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrom... 41 0.008 AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. 41 0.008 AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. 41 0.008 BC065551-1|AAH65551.1| 440|Homo sapiens WAS/WASL interacting pr... 39 0.025 AJ431177-1|CAD24007.1| 440|Homo sapiens WIRE protein protein. 39 0.025 AB043786-1|BAB85113.1| 440|Homo sapiens WICH protein. 39 0.025 BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. 39 0.034 AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. 39 0.034 AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen ... 39 0.034 X86019-1|CAA60014.1| 494|Homo sapiens SH3-domain interacting pr... 37 0.10 BX640870-1|CAE45928.1| 510|Homo sapiens hypothetical protein pr... 37 0.10 BC110288-1|AAI10289.1| 403|Homo sapiens WIPF1 protein protein. 37 0.10 AF106062-1|AAD45972.1| 312|Homo sapiens Wiskott-Aldrich syndrom... 37 0.10 AF031588-1|AAC03767.1| 503|Homo sapiens WASP interacting protei... 37 0.10 AC010894-2|AAY14708.1| 503|Homo sapiens unknown protein. 37 0.10 L20969-1|AAC00042.1| 809|Homo sapiens cyclic AMP phosphodiester... 37 0.14 BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. 36 0.18 BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. 36 0.18 BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. 36 0.18 BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. 36 0.18 AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341... 36 0.18 AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens ... 36 0.18 AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens ... 36 0.18 AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. 36 0.24 AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein pr... 36 0.24 AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. 36 0.24 AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. 36 0.24 AF386649-1|AAL26987.1| 1362|Homo sapiens bromodomain-containing ... 36 0.24 Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Dro... 34 0.95 Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Dro... 34 0.95 Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. 34 0.95 Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. 34 0.95 DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activ... 34 0.95 BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. 34 0.95 AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (D... 34 0.95 AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activ... 34 0.95 AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activ... 34 0.95 AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activ... 34 0.95 AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activ... 34 0.95 U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. 33 1.3 U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome ... 33 1.3 L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease prot... 33 1.3 BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. 33 1.3 BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrom... 33 1.3 BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. 33 1.3 AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open readi... 33 1.3 AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open readi... 33 1.3 AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens ... 33 1.3 AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrom... 33 1.3 AB016794-1|BAA36753.1| 3144|Homo sapiens huntingtin protein. 33 1.3 BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. 33 1.7 BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. 33 1.7 BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. 33 1.7 BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled ... 33 1.7 AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. 33 1.7 AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. 33 1.7 AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens ... 33 2.2 AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens ... 33 2.2 AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. 33 2.2 AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. 33 2.2 X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage f... 32 2.9 X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. 32 2.9 BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosop... 32 2.9 BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. 32 2.9 AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. 32 2.9 AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosop... 32 2.9 AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosop... 32 2.9 AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosop... 32 2.9 AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosop... 32 2.9 AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ... 32 2.9 AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenyl... 32 2.9 AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens ... 32 2.9 AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens ... 32 2.9 AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. 32 2.9 X95735-1|CAA65050.1| 572|Homo sapiens zyxin protein. 32 3.9 X94991-1|CAA64447.1| 572|Homo sapiens zyxin protein. 32 3.9 CR457431-1|CAG33712.1| 572|Homo sapiens ZYX protein. 32 3.9 BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, mem... 32 3.9 BC010031-1|AAH10031.1| 572|Homo sapiens zyxin protein. 32 3.9 BC009360-1|AAH09360.1| 572|Homo sapiens zyxin protein. 32 3.9 BC008743-1|AAH08743.1| 572|Homo sapiens zyxin protein. 32 3.9 AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, mem... 32 3.9 AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrom... 32 3.9 AJ007041-1|CAB45385.1| 2715|Homo sapiens trithorax homologue 2 p... 32 3.9 AF186605-1|AAD56420.1| 2605|Homo sapiens MLL2 protein protein. 32 3.9 AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. 32 3.9 AC092214-1|AAS07459.1| 572|Homo sapiens unknown protein. 32 3.9 AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein pro... 32 3.9 AB002302-1|BAA20763.3| 2415|Homo sapiens KIAA0304 protein protein. 32 3.9 D50857-1|BAA09454.1| 1865|Homo sapiens DOCK180 protein protein. 31 5.1 BX470201-1|CAH72560.2| 1865|Homo sapiens dedicator of cytokinesi... 31 5.1 BX470155-1|CAI22477.2| 1865|Homo sapiens dedicator of cytokinesi... 31 5.1 BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precu... 31 5.1 BC037223-1|AAH37223.1| 194|Homo sapiens mediator complex subuni... 31 5.1 BC035907-1|AAH35907.1| 308|Homo sapiens USP51 protein protein. 31 5.1 BC009723-1|AAH09723.1| 205|Homo sapiens Unknown (protein for IM... 31 5.1 BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IM... 31 5.1 AY152730-1|AAN75525.1| 665|Homo sapiens Rap1-interacting adapto... 31 5.1 AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein pr... 31 5.1 AL607029-1|CAI15329.2| 1865|Homo sapiens dedicator of cytokinesi... 31 5.1 AL390920-1|CAH73231.2| 1865|Homo sapiens dedicator of cytokinesi... 31 5.1 AL359094-1|CAH71477.2| 1865|Homo sapiens dedicator of cytokinesi... 31 5.1 AL355316-1|CAI16871.2| 1865|Homo sapiens dedicator of cytokinesi... 31 5.1 AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precu... 31 5.1 AL157711-1|CAH71463.2| 1865|Homo sapiens dedicator of cytokinesi... 31 5.1 AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific prot... 31 5.1 AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. 31 5.1 AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73... 31 5.1 AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. 31 5.1 AB058717-1|BAB47443.1| 1285|Homo sapiens KIAA1814 protein protein. 31 5.1 AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. 31 5.1 D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. 31 6.7 DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. 31 6.7 DQ067452-1|AAZ23039.1| 229|Homo sapiens diaphanous-1 protein. 31 6.7 BX284686-2|CAM26210.1| 306|Homo sapiens proline-rich transmembr... 31 6.7 BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 p... 31 6.7 BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (D... 31 6.7 BC063046-1|AAH63046.1| 306|Homo sapiens proline-rich transmembr... 31 6.7 BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, mem... 31 6.7 AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. 31 6.7 AY360322-1|AAQ64023.1| 179|Homo sapiens diaphanous 1 protein. 31 6.7 AL845464-1|CAI41794.2| 306|Homo sapiens proline-rich transmembr... 31 6.7 AL662884-7|CAI18339.2| 306|Homo sapiens proline-rich transmembr... 31 6.7 AL662828-7|CAI17422.2| 306|Homo sapiens proline-rich transmembr... 31 6.7 AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, mem... 31 6.7 AK054885-1|BAB70821.1| 306|Homo sapiens protein ( Homo sapiens ... 31 6.7 AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. 31 6.7 AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant pr... 31 6.7 AB084087-1|BAC67014.1| 1422|Homo sapiens Formactin2 protein. 31 6.7 AB051482-1|BAB21786.1| 1199|Homo sapiens KIAA1695 protein protein. 31 6.7 AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SE... 31 6.7 AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. 31 6.7 Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for ... 31 8.9 X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. 31 8.9 X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. 31 8.9 M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. 31 8.9 CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. 31 8.9 AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. 31 8.9 AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain... 31 8.9 AL353637-4|CAH70683.1| 432|Homo sapiens forkhead box B2 protein. 31 8.9 AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens ... 31 8.9 AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. 31 8.9 AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. 31 8.9 AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. 31 8.9 >D88460-1|BAA20128.1| 505|Homo sapiens N-WASP protein. Length = 505 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP GPPPP Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPP 388 Score = 38.7 bits (86), Expect = 0.034 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 36.7 bits (81), Expect = 0.14 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP GPPPP Sbjct: 277 PPPPPP------SRGGPPPPPPPPHSSGPPPP 302 Score = 33.1 bits (72), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 322 PPPPPP------SRPSVEVPPPPPNRMYPPPP 347 >BC052955-1|AAH52955.1| 505|Homo sapiens Wiskott-Aldrich syndrome-like protein. Length = 505 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP GPPPP Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPP 388 Score = 38.7 bits (86), Expect = 0.034 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 36.7 bits (81), Expect = 0.14 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP GPPPP Sbjct: 277 PPPPPP------SRGGPPPPPPPPHNSGPPPP 302 Score = 33.1 bits (72), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 322 PPPPPP------SRPSVAVPPPPPNRMYPPPP 347 >AM295156-1|CAL26602.1| 505|Homo sapiens WASL protein protein. Length = 505 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP GPPPP Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPP 388 Score = 38.7 bits (86), Expect = 0.034 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 36.7 bits (81), Expect = 0.14 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP GPPPP Sbjct: 277 PPPPPP------SRGGPPPPPPPPHNSGPPPP 302 Score = 33.1 bits (72), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 322 PPPPPP------SRPSVAVPPPPPNRMYPPPP 347 >AC006333-1|AAQ96857.1| 505|Homo sapiens unknown protein. Length = 505 Score = 40.7 bits (91), Expect = 0.008 Identities = 15/31 (48%), Positives = 16/31 (51%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP GPPPP Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPP 388 Score = 38.7 bits (86), Expect = 0.034 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 358 PPPPPPSVLGVGPVAPPPPPPPPPPPGPPPPP 389 Score = 36.7 bits (81), Expect = 0.14 Identities = 16/32 (50%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP GPPPP Sbjct: 277 PPPPPP------SRGGPPPPPPPPHNSGPPPP 302 Score = 33.1 bits (72), Expect = 1.7 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 322 PPPPPP------SRPSVAVPPPPPNRMYPPPP 347 >BC065551-1|AAH65551.1| 440|Homo sapiens WAS/WASL interacting protein family, member 2 protein. Length = 440 Score = 39.1 bits (87), Expect = 0.025 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPP--XXXGPPPP 512 G PPPPPP + + PPPPP GPPPP Sbjct: 335 GARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPP 373 Score = 32.3 bits (70), Expect = 2.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 474 PPPPPXXXGPPPPXXF 521 PPPPP GPPPP F Sbjct: 4 PPPPPPPPGPPPPPTF 19 >AJ431177-1|CAD24007.1| 440|Homo sapiens WIRE protein protein. Length = 440 Score = 39.1 bits (87), Expect = 0.025 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPP--XXXGPPPP 512 G PPPPPP + + PPPPP GPPPP Sbjct: 335 GARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPP 373 Score = 32.3 bits (70), Expect = 2.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 474 PPPPPXXXGPPPPXXF 521 PPPPP GPPPP F Sbjct: 4 PPPPPPPPGPPPPPTF 19 >AB043786-1|BAB85113.1| 440|Homo sapiens WICH protein. Length = 440 Score = 39.1 bits (87), Expect = 0.025 Identities = 17/39 (43%), Positives = 19/39 (48%), Gaps = 2/39 (5%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPP--XXXGPPPP 512 G PPPPPP + + PPPPP GPPPP Sbjct: 335 GARDAPPPPPPYRMHGSEPPSRGKPPPPPSRTPAGPPPP 373 Score = 32.3 bits (70), Expect = 2.9 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = +3 Query: 474 PPPPPXXXGPPPPXXF 521 PPPPP GPPPP F Sbjct: 4 PPPPPPPPGPPPPPTF 19 >BC073988-1|AAH73988.1| 682|Homo sapiens FMNL1 protein protein. Length = 682 Score = 38.7 bits (86), Expect = 0.034 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 G PPPPPP + PPPPP GPP Sbjct: 164 GDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 198 Score = 34.7 bits (76), Expect = 0.55 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP G PP Sbjct: 168 PPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 198 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPP PP PPPPP GP PP Sbjct: 155 EPPPAPPLPGDLPP--PPPPPPPPPGTDGPVPP 185 >AY278319-1|AAP32476.1| 1100|Homo sapiens leukocyte formin protein. Length = 1100 Score = 38.7 bits (86), Expect = 0.034 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 G PPPPPP + PPPPP GPP Sbjct: 582 GDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 616 Score = 34.7 bits (76), Expect = 0.55 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP G PP Sbjct: 586 PPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 616 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPP PP PPPPP GP PP Sbjct: 573 EPPPAPPLPGDLPP--PPPPPPPPPGTDGPVPP 603 >AF432213-1|AAL99920.1| 991|Homo sapiens CLL-associated antigen KW-13 protein. Length = 991 Score = 38.7 bits (86), Expect = 0.034 Identities = 15/35 (42%), Positives = 16/35 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 G PPPPPP + PPPPP GPP Sbjct: 473 GDLPPPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 507 Score = 34.7 bits (76), Expect = 0.55 Identities = 14/31 (45%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP PPPPP G PP Sbjct: 477 PPPPPPPPPPGTDGPVPPPPPPPPPPPGGPP 507 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/33 (42%), Positives = 15/33 (45%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPP PP PPPPP GP PP Sbjct: 464 EPPPAPPLPGDLPP--PPPPPPPPPGTDGPVPP 494 >X86019-1|CAA60014.1| 494|Homo sapiens SH3-domain interacting protein protein. Length = 494 Score = 37.1 bits (82), Expect = 0.10 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KPPPPPP + PPPPP PP P Sbjct: 263 KPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 >BX640870-1|CAE45928.1| 510|Homo sapiens hypothetical protein protein. Length = 510 Score = 37.1 bits (82), Expect = 0.10 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KPPPPPP + PPPPP PP P Sbjct: 263 KPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 >BC110288-1|AAI10289.1| 403|Homo sapiens WIPF1 protein protein. Length = 403 Score = 37.1 bits (82), Expect = 0.10 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KPPPPPP + PPPPP PP P Sbjct: 263 KPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 >AF106062-1|AAD45972.1| 312|Homo sapiens Wiskott-Aldrich syndrome protein interacting protein protein. Length = 312 Score = 37.1 bits (82), Expect = 0.10 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KPPPPPP + PPPPP PP P Sbjct: 72 KPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 104 >AF031588-1|AAC03767.1| 503|Homo sapiens WASP interacting protein protein. Length = 503 Score = 37.1 bits (82), Expect = 0.10 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KPPPPPP + PPPPP PP P Sbjct: 263 KPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 >AC010894-2|AAY14708.1| 503|Homo sapiens unknown protein. Length = 503 Score = 37.1 bits (82), Expect = 0.10 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 KPPPPPP + PPPPP PP P Sbjct: 263 KPPPPPPPVGNRPSIHREAVPPPPPQNNKPPVP 295 >L20969-1|AAC00042.1| 809|Homo sapiens cyclic AMP phosphodiesterase protein. Length = 809 Score = 36.7 bits (81), Expect = 0.14 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP + PPPPP PPPP Sbjct: 58 PPPPPPSPQPQPQCPLQPPPPPPLPPPPPPP 88 Score = 35.5 bits (78), Expect = 0.31 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 58 PPPPPPSPQPQPQ--CPLQPPPPPPLPPPPPP 87 >BC146811-1|AAI46812.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 36.3 bits (80), Expect = 0.18 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 +PPPPPP PPPPP GPP Sbjct: 177 QPPPPPPPPPPLPPPPPPQPPPPPPQSLGPP 207 >BC132873-1|AAI32874.1| 854|Homo sapiens ZNF341 protein protein. Length = 854 Score = 36.3 bits (80), Expect = 0.18 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 +PPPPPP PPPPP GPP Sbjct: 177 QPPPPPPPPPPLPPPPPPQPPPPPPQSLGPP 207 >BC117407-1|AAI17408.1| 1081|Homo sapiens LOC152485 protein protein. Length = 1081 Score = 36.3 bits (80), Expect = 0.18 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP KK K PPPPP PPPP Sbjct: 314 PLPPPPSE----KKPEKVTPPPPPPPPPPPPP 341 Score = 34.3 bits (75), Expect = 0.72 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 P PPP +K+ PPPPP PPP Sbjct: 314 PLPPPPSEKKPEKVTPPPPPPPPPPPPPPP 343 >BC094738-1|AAH94738.1| 795|Homo sapiens ZNF341 protein protein. Length = 795 Score = 36.3 bits (80), Expect = 0.18 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 +PPPPPP PPPPP GPP Sbjct: 118 QPPPPPPPPPPLPPPPPPQPPPPPPQSLGPP 148 >AL050349-3|CAI21796.2| 847|Homo sapiens zinc finger protein 341 protein. Length = 847 Score = 36.3 bits (80), Expect = 0.18 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPP 506 +PPPPPP PPPPP GPP Sbjct: 177 QPPPPPPPPPPLPPPPPPQPPPPPPQSLGPP 207 >AK127078-1|BAC86815.1| 844|Homo sapiens protein ( Homo sapiens cDNA FLJ45135 fis, clone BRAWH3038252, highly similar to Formin 1 isoform IV. ). Length = 844 Score = 36.3 bits (80), Expect = 0.18 Identities = 17/39 (43%), Positives = 17/39 (43%), Gaps = 3/39 (7%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXP---PPPPXXXGPPPPXXFF 524 PPPPPP P PPPP PPPP FF Sbjct: 348 PPPPPPPLPNSPAPPNPGGPPPAPPPPGLAPPPPPGLFF 386 Score = 35.9 bits (79), Expect = 0.24 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 331 PPPPPPPLPPPSSAGPPPPPPPPPLPNSPAPP 362 Score = 34.7 bits (76), Expect = 0.55 Identities = 14/37 (37%), Positives = 14/37 (37%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP P P Sbjct: 325 GPPLPPPPPPPPPLPPPSSAGPPPPPPPPPLPNSPAP 361 >AK091130-1|BAC03591.1| 1077|Homo sapiens protein ( Homo sapiens cDNA FLJ33811 fis, clone CTONG2002095. ). Length = 1077 Score = 36.3 bits (80), Expect = 0.18 Identities = 17/32 (53%), Positives = 17/32 (53%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP KK K PPPPP PPPP Sbjct: 314 PLPPPPSE----KKPEKVTPPPPPPPPPPPPP 341 Score = 34.3 bits (75), Expect = 0.72 Identities = 13/30 (43%), Positives = 15/30 (50%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 P PPP +K+ PPPPP PPP Sbjct: 314 PLPPPPSEKKPEKVTPPPPPPPPPPPPPPP 343 >AL158217-11|CAI22163.1| 854|Homo sapiens espin protein. Length = 854 Score = 35.9 bits (79), Expect = 0.24 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 430 PPPPPPSFPPPPPPPGTQLPPPPPGYPAPKPP 461 Score = 31.9 bits (69), Expect = 3.9 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 G KP PPPP PPPPP PPPP + Sbjct: 423 GTIGKPTPPPPPPSFPP-------PPPPPGTQLPPPPPGY 455 >AL035288-1|CAA22892.1| 671|Homo sapiens hypothetical protein protein. Length = 671 Score = 35.9 bits (79), Expect = 0.24 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 332 PPPPPPSFPPPPPPPGTQLPPPPPSYPSPKPP 363 >AL031848-3|CAI19773.1| 854|Homo sapiens espin protein. Length = 854 Score = 35.9 bits (79), Expect = 0.24 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 430 PPPPPPSFPPPPPPPGTQLPPPPPGYPAPKPP 461 Score = 31.9 bits (69), Expect = 3.9 Identities = 16/40 (40%), Positives = 17/40 (42%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 G KP PPPP PPPPP PPPP + Sbjct: 423 GTIGKPTPPPPPPSFPP-------PPPPPGTQLPPPPPGY 455 >AL021920-3|CAI19632.1| 671|Homo sapiens espin pseudogene protein. Length = 671 Score = 35.9 bits (79), Expect = 0.24 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP P PP Sbjct: 332 PPPPPPSFPPPPPPPGTQLPPPPPSYPSPKPP 363 >AF386649-1|AAL26987.1| 1362|Homo sapiens bromodomain-containing 4 protein. Length = 1362 Score = 35.9 bits (79), Expect = 0.24 Identities = 13/31 (41%), Positives = 17/31 (54%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PP PPP +++ + PPPPP PPP Sbjct: 956 PPLPPPPHPSVQQQLQQQPPPPPPPQPQPPP 986 Score = 33.5 bits (73), Expect = 1.3 Identities = 13/32 (40%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPP PP ++ + PPPPP PPP Sbjct: 955 PPPLPPPPHPSVQQQLQQQPPPPPPPQPQPPP 986 >Z86061-3|CAI42258.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >Z86061-2|CAI42257.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >Y15909-1|CAA75870.1| 1101|Homo sapiens DIA-156 protein protein. Length = 1101 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >Y15908-1|CAA75869.1| 1096|Homo sapiens DIA-12C protein protein. Length = 1096 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >DQ854815-1|ABI75145.1| 112|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated potassium channel 2 protein. Length = 112 Score = 33.9 bits (74), Expect = 0.95 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP ++ PP PP GP PP Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAPPPGPGPAPP 52 >BC117414-1|AAI17415.1| 1103|Homo sapiens DIAPH2 protein protein. Length = 1103 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 580 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 612 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 598 PPPPPPPL------LFGGPPPPPPLGGVPPPP 623 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 569 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 600 >AL669876-2|CAH71114.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL669876-1|CAH71113.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL606530-3|CAI39842.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL606530-2|CAI39841.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL592157-3|CAI40545.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL592157-2|CAI40544.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL391821-1|CAH71361.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL161624-2|CAI40916.1| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL161624-1|CAI40915.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL139809-2|CAD13477.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL139809-1|CAI39928.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL031053-2|CAB39108.2| 1096|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1096 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AL031053-1|CAI42515.1| 1101|Homo sapiens diaphanous homolog 2 (Drosophila) protein. Length = 1101 Score = 33.9 bits (74), Expect = 0.95 Identities = 16/37 (43%), Positives = 17/37 (45%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP + PPPPP G PPP Sbjct: 573 GGAPLPPPPPPLPG----MMGIPPPPPPPLLFGGPPP 605 Score = 33.5 bits (73), Expect = 1.3 Identities = 15/32 (46%), Positives = 16/32 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 591 PPPPPPPL------LFGGPPPPPPLGGVPPPP 616 Score = 33.1 bits (72), Expect = 1.7 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P G PPP Sbjct: 562 PPPPPPAPPLPGGAPLPPPPPPLPGMMGIPPP 593 >AJ133727-1|CAB42630.1| 889|Homo sapiens hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 protein. Length = 889 Score = 33.9 bits (74), Expect = 0.95 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP ++ PP PP GP PP Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAPPPGPGPAPP 52 >AJ012582-1|CAB42602.1| 889|Homo sapiens hyperpolarization-activated cation channel HCN2 protein. Length = 889 Score = 33.9 bits (74), Expect = 0.95 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP ++ PP PP GP PP Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAPPPGPGPAPP 52 >AF065164-1|AAC28444.2| 889|Homo sapiens hyperpolarization-activated, cyclic nucleotide-gated channel 2 protein. Length = 889 Score = 33.9 bits (74), Expect = 0.95 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP ++ PP PP GP PP Sbjct: 22 PPPPPPPRPPKQQPPPPPPPAPPPGPGPAPP 52 >AC005559-2|AAC33280.2| 528|Homo sapiens hyperpolarization activated cyclic nucleotide-gated potassium channel 2 protein. Length = 528 Score = 33.9 bits (74), Expect = 0.95 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPP ++ PP PP GP PP Sbjct: 22 PPPPPPPAPPQQQPPPPPPPAPPPGPGPAPP 52 >U19927-1|AAC50140.1| 502|Homo sapiens WAS protein. Length = 502 Score = 33.5 bits (73), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP GPP P Sbjct: 363 GRGGPPPPPPPATGRSG-----PLPPPPPGAGGPPMP 394 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPX-XXGPPPP 512 PPPPP PPPPP GP PP Sbjct: 382 PPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 >U12707-1|AAA62663.1| 502|Homo sapiens Wiskott-Aldrich syndrome protein protein. Length = 502 Score = 33.5 bits (73), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP GPP P Sbjct: 363 GRGGPPPPPPPATGRSG-----PLPPPPPGAGGPPMP 394 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPX-XXGPPPP 512 PPPPP PPPPP GP PP Sbjct: 382 PPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 >L12392-1|AAB38240.1| 3144|Homo sapiens Huntington's Disease protein protein. Length = 3144 Score = 33.5 bits (73), Expect = 1.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + P P P PPPP Sbjct: 46 PPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPP 77 >BC038446-1|AAH38446.1| 673|Homo sapiens SF1 protein protein. Length = 673 Score = 33.5 bits (73), Expect = 1.3 Identities = 13/31 (41%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP ++ PPP P PPP Sbjct: 69 PPPPPPPPPPPPQQPPPPPPPPSPGASYPPP 99 Score = 32.3 bits (70), Expect = 2.9 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 ++PPPPPP PPPPP PP Sbjct: 81 QQPPPPPPPPSPGASYPPPQPPPPPPLYQRVSPP 114 >BC012738-1|AAH12738.1| 502|Homo sapiens Wiskott-Aldrich syndrome (eczema-thrombocytopenia) protein. Length = 502 Score = 33.5 bits (73), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP GPP P Sbjct: 363 GRGGPPPPPPPATGRSG-----PLPPPPPGAGGPPMP 394 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPX-XXGPPPP 512 PPPPP PPPPP GP PP Sbjct: 382 PPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 >BC002961-1|AAH02961.1| 514|Homo sapiens WAS protein protein. Length = 514 Score = 33.5 bits (73), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP GPP P Sbjct: 375 GRGGPPPPPPPATGRSG-----PLPPPPPGAGGPPMP 406 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPX-XXGPPPP 512 PPPPP PPPPP GP PP Sbjct: 394 PPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPP 425 >AL096764-2|CAM28218.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 33.5 bits (73), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 915 GASLPPPPPPPPPP------PPPPPPPPPPPPPPPPP 945 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 938 PPPPPPPPALDVGETSNLQPPPPL----PPPP 965 >AL049563-1|CAM28289.1| 1137|Homo sapiens chromosome X open reading frame 45 protein. Length = 1137 Score = 33.5 bits (73), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP PPPP Sbjct: 915 GASLPPPPPPPPPP------PPPPPPPPPPPPPPPPP 945 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 938 PPPPPPPPALDVGETSNLQPPPPL----PPPP 965 >AK075231-1|BAC11488.1| 169|Homo sapiens protein ( Homo sapiens cDNA FLJ90750 fis, clone PLACE2000118, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN HOMOLOG. ). Length = 169 Score = 33.5 bits (73), Expect = 1.3 Identities = 16/39 (41%), Positives = 17/39 (43%), Gaps = 7/39 (17%) Frame = +3 Query: 417 PPPPPPXXXXXX-------KKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP GPPPP Sbjct: 38 PPPPPPAADYPTLPPPPLSQPTGGAPPPPPPPPPGPPPP 76 >AF115549-1|AAD26691.1| 502|Homo sapiens Wiskott-Aldrich Syndrome protein protein. Length = 502 Score = 33.5 bits (73), Expect = 1.3 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP GPP P Sbjct: 363 GRGGPPPPPPPATGRSG-----PLPPPPPGAGGPPMP 394 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 14/32 (43%), Gaps = 1/32 (3%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPX-XXGPPPP 512 PPPPP PPPPP GP PP Sbjct: 382 PPPPPGAGGPPMPPPPPPPPPPPSSGNGPAPP 413 >AB016794-1|BAA36753.1| 3144|Homo sapiens huntingtin protein. Length = 3144 Score = 33.5 bits (73), Expect = 1.3 Identities = 13/32 (40%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + P P P PPPP Sbjct: 46 PPPPPPQLPQPPPQAQPLLPQPQPPPPPPPPP 77 >BC064999-1|AAH64999.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 33.1 bits (72), Expect = 1.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 546 GSLLPPPPPPPLPG------GMLPPPPPPLPPGGPPP 576 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 550 PPPPPPPLPGG---MLPPPPPPLPPGGPPPPP 578 >BC038428-1|AAH38428.1| 1068|Homo sapiens DAAM1 protein protein. Length = 1068 Score = 33.1 bits (72), Expect = 1.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 546 GSLLPPPPPPPLPG------GMLPPPPPPLPPGGPPP 576 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 550 PPPPPPPLPGG---MLPPPPPPLPPGGPPPPP 578 >BC034003-1|AAH34003.1| 600|Homo sapiens PRR12 protein protein. Length = 600 Score = 33.1 bits (72), Expect = 1.7 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 +KPPP PP + PPP P PPP Sbjct: 91 EKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPP 123 Score = 30.7 bits (66), Expect = 8.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P + PPP PPPP Sbjct: 111 PPPPQPALPSPPPLVAPTPSSPPPPPLPPPPP 142 >BC024781-1|AAH24781.1| 662|Homo sapiens Similar to dishevelled associated activator of morphogenesis 2 protein. Length = 662 Score = 33.1 bits (72), Expect = 1.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 140 GSLLPPPPPPPLPG------GMLPPPPPPLPPGGPPP 170 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 144 PPPPPPPLPGG---MLPPPPPPLPPGGPPPPP 172 >AB033031-1|BAA86519.1| 1217|Homo sapiens KIAA1205 protein protein. Length = 1217 Score = 33.1 bits (72), Expect = 1.7 Identities = 13/33 (39%), Positives = 15/33 (45%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 +KPPP PP + PPP P PPP Sbjct: 636 EKPPPTPPPAPTPQPQPPPPPPPPQPALPSPPP 668 Score = 30.7 bits (66), Expect = 8.9 Identities = 12/32 (37%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P + PPP PPPP Sbjct: 656 PPPPQPALPSPPPLVAPTPSSPPPPPLPPPPP 687 >AB014566-1|BAA31641.1| 1085|Homo sapiens KIAA0666 protein protein. Length = 1085 Score = 33.1 bits (72), Expect = 1.7 Identities = 16/37 (43%), Positives = 16/37 (43%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G PPPPPP PPPPP G PPP Sbjct: 553 GSLLPPPPPPPLPG------GMLPPPPPPLPPGGPPP 583 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 557 PPPPPPPLPGG---MLPPPPPPLPPGGPPPPP 585 >AK091683-1|BAC03720.1| 749|Homo sapiens protein ( Homo sapiens cDNA FLJ34364 fis, clone FEBRA2015175, weakly similar to Mus musculus (clone E5.53) Huntington disease (hdh) gene. ). Length = 749 Score = 32.7 bits (71), Expect = 2.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP PPP Sbjct: 655 PPPPPPPPPPPPLALPPPPPPPPPL---PPP 682 >AK056450-1|BAB71186.1| 568|Homo sapiens protein ( Homo sapiens cDNA FLJ31888 fis, clone NT2RP7003055. ). Length = 568 Score = 32.7 bits (71), Expect = 2.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP PPP Sbjct: 337 PPPPPPPPPPPPLALPPPPPPPPPL---PPP 364 >AB051514-1|BAB21818.1| 1130|Homo sapiens KIAA1727 protein protein. Length = 1130 Score = 32.7 bits (71), Expect = 2.2 Identities = 13/31 (41%), Positives = 14/31 (45%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPP PP + PPPPP G PP Sbjct: 28 PPPSPPCSCSREECPSSPPPPPPPPLPGEPP 58 Score = 31.1 bits (67), Expect = 6.7 Identities = 12/32 (37%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP P ++ PPPPP PP Sbjct: 27 PPPPSPPCSCSREECPSSPPPPPPPPLPGEPP 58 >AB051500-1|BAB21804.2| 1652|Homo sapiens KIAA1713 protein protein. Length = 1652 Score = 32.7 bits (71), Expect = 2.2 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP PPP Sbjct: 1421 PPPPPPPPPPPPLALPPPPPPPPPL---PPP 1448 >X67337-1|CAA47752.1| 551|Homo sapiens Human pre-mRNA cleavage factor I 68 kDa subunit protein. Length = 551 Score = 32.3 bits (70), Expect = 2.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PP PP GPPPP Sbjct: 226 PPPPFPAGQTPPRPPLGPPGPPGPPGPPPP 255 >X67336-1|CAA47751.1| 551|Homo sapiens HPBRII-7 protein. Length = 551 Score = 32.3 bits (70), Expect = 2.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PP PP GPPPP Sbjct: 226 PPPPFPAGQTPPRPPLGPPGPPGPPGPPPP 255 >BC095481-1|AAH95481.1| 591|Homo sapiens enabled homolog (Drosophila) protein. Length = 591 Score = 32.3 bits (70), Expect = 2.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP + PPPPP PP P F Sbjct: 347 PPPPPPPPP-----LPNQVPPPPPPPPAPPLPASGF 377 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPGPP---PPPP 341 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPP P PPPPP PPPP Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 30.7 bits (66), Expect = 8.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 402 GXXKKPPPPP----PXXXXXXKKIXKXXPPPPP-XXXGPPPP 512 G PPPPP P PPPPP GPPPP Sbjct: 309 GPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP 350 Score = 30.7 bits (66), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 336 PPPPPPLPSTGPP--PPPPPPPLPNQVPPPPP 365 >BC065238-1|AAH65238.1| 527|Homo sapiens ENAH protein protein. Length = 527 Score = 32.3 bits (70), Expect = 2.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP + PPPPP PP P F Sbjct: 304 PPPPPPPPP-----LPNQVPPPPPPPPAPPLPASGF 334 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 270 PPPPPPLPPGPAQASVALPPPPGPP---PPPP 298 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPP P PPPPP PPPP Sbjct: 288 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 321 Score = 30.7 bits (66), Expect = 8.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 402 GXXKKPPPPP----PXXXXXXKKIXKXXPPPPP-XXXGPPPP 512 G PPPPP P PPPPP GPPPP Sbjct: 266 GPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP 307 Score = 30.7 bits (66), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 293 PPPPPPLPSTGPP--PPPPPPPLPNQVPPPPP 322 >AY345143-1|AAR04685.1| 570|Homo sapiens MENA protein. Length = 570 Score = 32.3 bits (70), Expect = 2.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP + PPPPP PP P F Sbjct: 347 PPPPPPPPP-----LPNQVPPPPPPPPAPPLPASGF 377 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPGPP---PPPP 341 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPP P PPPPP PPPP Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 30.7 bits (66), Expect = 8.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 402 GXXKKPPPPP----PXXXXXXKKIXKXXPPPPP-XXXGPPPP 512 G PPPPP P PPPPP GPPPP Sbjct: 309 GPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP 350 Score = 30.7 bits (66), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 336 PPPPPPLPSTGPP--PPPPPPPLPNQVPPPPP 365 >AL591380-2|CAH71476.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 32.3 bits (70), Expect = 2.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP + PPPPP PP P F Sbjct: 347 PPPPPPPPP-----LPNQVPPPPPPPPAPPLPASGF 377 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPGPP---PPPP 341 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPP P PPPPP PPPP Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 30.7 bits (66), Expect = 8.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 402 GXXKKPPPPP----PXXXXXXKKIXKXXPPPPP-XXXGPPPP 512 G PPPPP P PPPPP GPPPP Sbjct: 309 GPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP 350 Score = 30.7 bits (66), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 336 PPPPPPLPSTGPP--PPPPPPPLPNQVPPPPP 365 >AL591380-1|CAH71475.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 32.3 bits (70), Expect = 2.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP + PPPPP PP P F Sbjct: 594 PPPPPP-----PPPLPNQVPPPPPPPPAPPLPASGF 624 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 560 PPPPPPLPPGPAQASVALPPPPGPP---PPPP 588 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPP P PPPPP PPPP Sbjct: 578 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 611 Score = 30.7 bits (66), Expect = 8.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 402 GXXKKPPPPP----PXXXXXXKKIXKXXPPPPP-XXXGPPPP 512 G PPPPP P PPPPP GPPPP Sbjct: 556 GPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP 597 Score = 30.7 bits (66), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 583 PPPPPPLPSTGPP--PPPPPPPLPNQVPPPPP 612 >AL356216-3|CAI22019.1| 570|Homo sapiens enabled homolog (Drosophila) protein. Length = 570 Score = 32.3 bits (70), Expect = 2.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP + PPPPP PP P F Sbjct: 347 PPPPPPPPP-----LPNQVPPPPPPPPAPPLPASGF 377 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPGPP---PPPP 341 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPP P PPPPP PPPP Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 30.7 bits (66), Expect = 8.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 402 GXXKKPPPPP----PXXXXXXKKIXKXXPPPPP-XXXGPPPP 512 G PPPPP P PPPPP GPPPP Sbjct: 309 GPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP 350 Score = 30.7 bits (66), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 336 PPPPPPLPSTGPP--PPPPPPPLPNQVPPPPP 365 >AL356216-2|CAI22020.1| 817|Homo sapiens enabled homolog (Drosophila) protein. Length = 817 Score = 32.3 bits (70), Expect = 2.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP + PPPPP PP P F Sbjct: 594 PPPPPP-----PPPLPNQVPPPPPPPPAPPLPASGF 624 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 560 PPPPPPLPPGPAQASVALPPPPGPP---PPPP 588 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPP P PPPPP PPPP Sbjct: 578 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 611 Score = 30.7 bits (66), Expect = 8.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 402 GXXKKPPPPP----PXXXXXXKKIXKXXPPPPP-XXXGPPPP 512 G PPPPP P PPPPP GPPPP Sbjct: 556 GPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP 597 Score = 30.7 bits (66), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 583 PPPPPPLPSTGPP--PPPPPPPLPNQVPPPPP 612 >AL078621-10|CAB81647.1| 232|Homo sapiens protein ( G islands. ).). Length = 232 Score = 32.3 bits (70), Expect = 2.9 Identities = 13/31 (41%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PP PP PPPPP PPPP Sbjct: 147 PPRPPAAQPRPPPSPPPPPPPPPSPLPPPPP 177 Score = 30.7 bits (66), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +P PP P PPPPP PPPP Sbjct: 144 RPLPPRPPAAQPRPPPSPPPPPPPPPSPLPPPP 176 >AK223568-1|BAD97288.1| 551|Homo sapiens cleavage and polyadenylation specific factor 6, 68 kD subunit variant protein. Length = 551 Score = 32.3 bits (70), Expect = 2.9 Identities = 13/30 (43%), Positives = 13/30 (43%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PP PP GPPPP Sbjct: 226 PPPPFPAGQTPPRPPLGPPGPPGPPGPPPP 255 >AK128867-1|BAC87651.1| 121|Homo sapiens protein ( Homo sapiens cDNA FLJ46838 fis, clone UTERU2035926. ). Length = 121 Score = 32.3 bits (70), Expect = 2.9 Identities = 14/37 (37%), Positives = 15/37 (40%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 G P PP P + PPPPP PPPP Sbjct: 68 GGVTAPRPPLPALHSAAPGLPPPPPPPPPPPPLPPPP 104 >AK096246-1|BAC04736.1| 467|Homo sapiens protein ( Homo sapiens cDNA FLJ38927 fis, clone NT2NE2012505, highly similar to Gallus gallus mRNA for avena. ). Length = 467 Score = 32.3 bits (70), Expect = 2.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP + PPPPP PP P F Sbjct: 244 PPPPPPPPP-----LPNQVPPPPPPPPAPPLPASGF 274 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 210 PPPPPPLPPGPAQASVALPPPPGPP---PPPP 238 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPP P PPPPP PPPP Sbjct: 228 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 261 Score = 30.7 bits (66), Expect = 8.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 402 GXXKKPPPPP----PXXXXXXKKIXKXXPPPPP-XXXGPPPP 512 G PPPPP P PPPPP GPPPP Sbjct: 206 GPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP 247 Score = 30.7 bits (66), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 233 PPPPPPLPSTGPP--PPPPPPPLPNQVPPPPP 262 >AF519769-1|AAQ08487.1| 591|Homo sapiens mena protein protein. Length = 591 Score = 32.3 bits (70), Expect = 2.9 Identities = 15/36 (41%), Positives = 16/36 (44%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXFF 524 PPPPPP + PPPPP PP P F Sbjct: 347 PPPPPPPPP-----LPNQVPPPPPPPPAPPLPASGF 377 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPP P PPPP Sbjct: 313 PPPPPPLPPGPAQASVALPPPPGPP---PPPP 341 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/34 (41%), Positives = 14/34 (41%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG--PPPP 512 PPPP P PPPPP PPPP Sbjct: 331 PPPPGPPPPPPLPSTGPPPPPPPPPLPNQVPPPP 364 Score = 30.7 bits (66), Expect = 8.9 Identities = 17/42 (40%), Positives = 17/42 (40%), Gaps = 5/42 (11%) Frame = +3 Query: 402 GXXKKPPPPP----PXXXXXXKKIXKXXPPPPP-XXXGPPPP 512 G PPPPP P PPPPP GPPPP Sbjct: 309 GPLAPPPPPPLPPGPAQASVALPPPPGPPPPPPLPSTGPPPP 350 Score = 30.7 bits (66), Expect = 8.9 Identities = 14/32 (43%), Positives = 14/32 (43%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP P PPPP Sbjct: 336 PPPPPPLPSTGPP--PPPPPPPLPNQVPPPPP 365 >X95735-1|CAA65050.1| 572|Homo sapiens zyxin protein. Length = 572 Score = 31.9 bits (69), Expect = 3.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPP P ++ + PPPP PPPP Sbjct: 45 EPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPP 77 >X94991-1|CAA64447.1| 572|Homo sapiens zyxin protein. Length = 572 Score = 31.9 bits (69), Expect = 3.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPP P ++ + PPPP PPPP Sbjct: 45 EPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPP 77 >CR457431-1|CAG33712.1| 572|Homo sapiens ZYX protein. Length = 572 Score = 31.9 bits (69), Expect = 3.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPP P ++ + PPPP PPPP Sbjct: 45 EPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPP 77 >BC040943-1|AAH40943.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 31.9 bits (69), Expect = 3.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PPPPP GPPPP Sbjct: 379 PPPPLSQPTG---GAPPPPPPPPPPGPPPP 405 >BC010031-1|AAH10031.1| 572|Homo sapiens zyxin protein. Length = 572 Score = 31.9 bits (69), Expect = 3.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPP P ++ + PPPP PPPP Sbjct: 45 EPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPP 77 >BC009360-1|AAH09360.1| 572|Homo sapiens zyxin protein. Length = 572 Score = 31.9 bits (69), Expect = 3.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPP P ++ + PPPP PPPP Sbjct: 45 EPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPP 77 >BC008743-1|AAH08743.1| 572|Homo sapiens zyxin protein. Length = 572 Score = 31.9 bits (69), Expect = 3.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPP P ++ + PPPP PPPP Sbjct: 45 EPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPP 77 >AL096774-6|CAC18518.1| 498|Homo sapiens WAS protein family, member 2 protein. Length = 498 Score = 31.9 bits (69), Expect = 3.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PPPPP GPPPP Sbjct: 379 PPPPLSQPTG---GAPPPPPPPPPPGPPPP 405 >AJ509090-1|CAD48858.1| 625|Homo sapiens Wiskott-Aldrich syndrome protein family member 4 protein. Length = 625 Score = 31.9 bits (69), Expect = 3.9 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP + PPPPP GPPPP Sbjct: 507 PPPPLS----QPTRGAPPPPPPPPPGPPPP 532 >AJ007041-1|CAB45385.1| 2715|Homo sapiens trithorax homologue 2 protein. Length = 2715 Score = 31.9 bits (69), Expect = 3.9 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPP--PPXXXGPPPP 512 PPP PP + PPP PP PPPP Sbjct: 414 PPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPP 447 Score = 31.5 bits (68), Expect = 5.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PP P Sbjct: 411 PSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLP 442 >AF186605-1|AAD56420.1| 2605|Homo sapiens MLL2 protein protein. Length = 2605 Score = 31.9 bits (69), Expect = 3.9 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPP--PPXXXGPPPP 512 PPP PP + PPP PP PPPP Sbjct: 304 PPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPP 337 Score = 31.5 bits (68), Expect = 5.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PP P Sbjct: 301 PSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLP 332 >AF134304-1|AAD33053.2| 496|Homo sapiens Scar2 protein. Length = 496 Score = 31.9 bits (69), Expect = 3.9 Identities = 14/30 (46%), Positives = 15/30 (50%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP + PPPPP GPPPP Sbjct: 378 PPPPLS----QPTRGAPPPPPPPPPGPPPP 403 >AC092214-1|AAS07459.1| 572|Homo sapiens unknown protein. Length = 572 Score = 31.9 bits (69), Expect = 3.9 Identities = 12/33 (36%), Positives = 16/33 (48%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +PPP P ++ + PPPP PPPP Sbjct: 45 EPPPAPGAQRAQMGRVGEIPPPPPEDFPLPPPP 77 >AB026542-1|BAA81795.1| 498|Homo sapiens WASP-family protein protein. Length = 498 Score = 31.9 bits (69), Expect = 3.9 Identities = 14/30 (46%), Positives = 14/30 (46%) Frame = +3 Query: 423 PPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPP PPPPP GPPPP Sbjct: 379 PPPPLSQPTG---GAPPPPPPPPPPGPPPP 405 >AB002302-1|BAA20763.3| 2415|Homo sapiens KIAA0304 protein protein. Length = 2415 Score = 31.9 bits (69), Expect = 3.9 Identities = 14/34 (41%), Positives = 15/34 (44%), Gaps = 2/34 (5%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPP--PPXXXGPPPP 512 PPP PP + PPP PP PPPP Sbjct: 114 PPPLPPPSTSPPPPLCPPPPPPVSPPPLPSPPPP 147 Score = 31.5 bits (68), Expect = 5.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PPPP PPPPP PP P Sbjct: 111 PSPPPPLPPPSTSPPPPLCPPPPPPVSPPPLP 142 >D50857-1|BAA09454.1| 1865|Homo sapiens DOCK180 protein protein. Length = 1865 Score = 31.5 bits (68), Expect = 5.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP + PPPPP Sbjct: 1826 PPPPPPHQRHLPPPLPSKTPPPPP 1849 >BX470201-1|CAH72560.2| 1865|Homo sapiens dedicator of cytokinesis 1 protein. Length = 1865 Score = 31.5 bits (68), Expect = 5.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP + PPPPP Sbjct: 1826 PPPPPPHQRHLPPPLPSKTPPPPP 1849 >BX470155-1|CAI22477.2| 1865|Homo sapiens dedicator of cytokinesis 1 protein. Length = 1865 Score = 31.5 bits (68), Expect = 5.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP + PPPPP Sbjct: 1826 PPPPPPHQRHLPPPLPSKTPPPPP 1849 >BC054516-1|AAH54516.1| 666|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 1 interacting pro protein. Length = 666 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP PPP Sbjct: 555 PPPPPPPPLDDPE-----LPPPPPDFMEPPP 580 Score = 31.5 bits (68), Expect = 5.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP PPPP Sbjct: 557 PPPPPPLDDPELPPPPPDFMEPPPDFVPPPPP 588 >BC037223-1|AAH37223.1| 194|Homo sapiens mediator complex subunit 19 protein. Length = 194 Score = 31.5 bits (68), Expect = 5.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGP---PPP 512 G PPPPP K PPPPP GP PPP Sbjct: 9 GAQADPPPPPTALGFGPGK--PPPPPPPPAGGGPGTAPPP 46 >BC035907-1|AAH35907.1| 308|Homo sapiens USP51 protein protein. Length = 308 Score = 31.5 bits (68), Expect = 5.1 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +KP P P + PPPPP PPPP Sbjct: 102 RKPRPRPQPRARSRSQPGLSAPPPPPARPPPPPP 135 >BC009723-1|AAH09723.1| 205|Homo sapiens Unknown (protein for IMAGE:3895048) protein. Length = 205 Score = 31.5 bits (68), Expect = 5.1 Identities = 17/40 (42%), Positives = 17/40 (42%), Gaps = 3/40 (7%) Frame = +3 Query: 402 GXXKKPPPPPPXXXXXXKKIXKXXPPPPPXXXGP---PPP 512 G PPPPP K PPPPP GP PPP Sbjct: 9 GAQADPPPPPTALGFGPGK--PPPPPPPPAGGGPGTAPPP 46 >BC006419-1|AAH06419.1| 39|Homo sapiens Unknown (protein for IMAGE:3946309) protein. Length = 39 Score = 31.5 bits (68), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 13 PPPPPPLRP----------PPPPPPLPPPPPP 34 >AY152730-1|AAN75525.1| 665|Homo sapiens Rap1-interacting adaptor molecule protein. Length = 665 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP PPP Sbjct: 555 PPPPPPPPLDDPE-----LPPPPPDFMEPPP 580 Score = 31.5 bits (68), Expect = 5.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP PPPP Sbjct: 557 PPPPPPLDDPELPPPPPDFMEPPPDFVPPPPP 588 >AL834396-1|CAD39058.1| 1009|Homo sapiens hypothetical protein protein. Length = 1009 Score = 31.5 bits (68), Expect = 5.1 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 7/39 (17%) Frame = +3 Query: 417 PPPPPPXXXXXXKK-------IXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 443 PPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPP 481 Score = 31.5 bits (68), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 469 PPPPPPPPP----------PPPPPPPPPPPPP 490 >AL607029-1|CAI15329.2| 1865|Homo sapiens dedicator of cytokinesis 1 protein. Length = 1865 Score = 31.5 bits (68), Expect = 5.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP + PPPPP Sbjct: 1826 PPPPPPHQRHLPPPLPSKTPPPPP 1849 >AL390920-1|CAH73231.2| 1865|Homo sapiens dedicator of cytokinesis 1 protein. Length = 1865 Score = 31.5 bits (68), Expect = 5.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP + PPPPP Sbjct: 1826 PPPPPPHQRHLPPPLPSKTPPPPP 1849 >AL359094-1|CAH71477.2| 1865|Homo sapiens dedicator of cytokinesis 1 protein. Length = 1865 Score = 31.5 bits (68), Expect = 5.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP + PPPPP Sbjct: 1826 PPPPPPHQRHLPPPLPSKTPPPPP 1849 >AL355316-1|CAI16871.2| 1865|Homo sapiens dedicator of cytokinesis 1 protein. Length = 1865 Score = 31.5 bits (68), Expect = 5.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP + PPPPP Sbjct: 1826 PPPPPPHQRHLPPPLPSKTPPPPP 1849 >AL160287-2|CAH70339.1| 666|Homo sapiens amyloid beta (A4) precursor protein-binding, family B, member 1 interacting pro protein. Length = 666 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP PPP Sbjct: 555 PPPPPPPPLDDPE-----LPPPPPDFMEPPP 580 Score = 31.5 bits (68), Expect = 5.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP PPPP Sbjct: 557 PPPPPPLDDPELPPPPPDFMEPPPDFVPPPPP 588 >AL157711-1|CAH71463.2| 1865|Homo sapiens dedicator of cytokinesis 1 protein. Length = 1865 Score = 31.5 bits (68), Expect = 5.1 Identities = 11/24 (45%), Positives = 12/24 (50%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPP 488 PPPPPP + PPPPP Sbjct: 1826 PPPPPPHQRHLPPPLPSKTPPPPP 1849 >AJ583823-1|CAE47750.2| 711|Homo sapiens ubiquitin specific proteinase 51 protein. Length = 711 Score = 31.5 bits (68), Expect = 5.1 Identities = 13/34 (38%), Positives = 15/34 (44%) Frame = +3 Query: 411 KKPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +KP P P + PPPPP PPPP Sbjct: 102 RKPRPRPQPRARSRSQPGLSAPPPPPARPPPPPP 135 >AF051782-1|AAC05373.1| 1248|Homo sapiens diaphanous 1 protein. Length = 1248 Score = 31.5 bits (68), Expect = 5.1 Identities = 15/36 (41%), Positives = 15/36 (41%), Gaps = 4/36 (11%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXG----PPPP 512 PPPP P PPPPP G PPPP Sbjct: 588 PPPPAPGDSTTPPPPPPPPPPPPPLPGGTAISPPPP 623 Score = 31.1 bits (67), Expect = 6.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPP P G PPP F Sbjct: 680 PPPPPPLPGEAGMP---PPPPPLPGGPGIPPPPPF 711 >AB085852-1|BAC41256.1| 666|Homo sapiens proline-rich protein 73 protein. Length = 666 Score = 31.5 bits (68), Expect = 5.1 Identities = 14/31 (45%), Positives = 15/31 (48%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + PPPPP PPP Sbjct: 555 PPPPPPPPLDDPE-----LPPPPPDFMEPPP 580 Score = 31.5 bits (68), Expect = 5.1 Identities = 13/32 (40%), Positives = 13/32 (40%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPP PPPP Sbjct: 557 PPPPPPLDDPELPPPPPDFMEPPPDFVPPPPP 588 >AB067489-1|BAB67795.1| 1112|Homo sapiens KIAA1902 protein protein. Length = 1112 Score = 31.5 bits (68), Expect = 5.1 Identities = 15/39 (38%), Positives = 16/39 (41%), Gaps = 7/39 (17%) Frame = +3 Query: 417 PPPPPPXXXXXXKK-------IXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPPP Sbjct: 546 PPPPPPLPPSSDTPETVQNGPVTPPMPPPPPPPPPPPPP 584 Score = 31.5 bits (68), Expect = 5.1 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 572 PPPPPPPPP----------PPPPPPPPPPPPP 593 >AB058717-1|BAB47443.1| 1285|Homo sapiens KIAA1814 protein protein. Length = 1285 Score = 31.5 bits (68), Expect = 5.1 Identities = 13/32 (40%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + + P PP PPPP Sbjct: 1141 PPPPPPPPLPPPAHLGR-SPAGPPVLHAPPPP 1171 >AB002337-1|BAA20797.2| 1709|Homo sapiens KIAA0339 protein protein. Length = 1709 Score = 31.5 bits (68), Expect = 5.1 Identities = 15/38 (39%), Positives = 16/38 (42%), Gaps = 6/38 (15%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPP------PPXXXGPPPP 512 PPPPPP + PP PP GPPPP Sbjct: 609 PPPPPPPPPPYLASLPLGYPPHQPAYLLPPRPDGPPPP 646 >D87459-1|BAA13399.2| 567|Homo sapiens KIAA0269 protein. Length = 567 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXX---PPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 333 PPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPP 367 >DQ067453-1|AAZ23040.1| 1262|Homo sapiens diaphanous-1 protein. Length = 1262 Score = 31.1 bits (67), Expect = 6.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPP P G PPP F Sbjct: 691 PPPPPPLPGEAGMP---PPPPPLPGGPGIPPPPPF 722 >DQ067452-1|AAZ23039.1| 229|Homo sapiens diaphanous-1 protein. Length = 229 Score = 31.1 bits (67), Expect = 6.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPP P G PPP F Sbjct: 85 PPPPPPLPGEAGMP---PPPPPLPGGPGIPPPPPF 116 >BX284686-2|CAM26210.1| 306|Homo sapiens proline-rich transmembrane protein 1 protein. Length = 306 Score = 31.1 bits (67), Expect = 6.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PP + PPPPP PPPP Sbjct: 105 PRMPPDPYLQETRFEGPLPPPPPAAAAPPPP 135 >BC146776-1|AAI46777.1| 1542|Homo sapiens SET binding protein 1 protein. Length = 1542 Score = 31.1 bits (67), Expect = 6.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 1469 PPPPPP-----------PLPPPPPPPLPPPPP 1489 >BC117257-1|AAI17258.1| 1262|Homo sapiens diaphanous homolog 1 (Drosophila) protein. Length = 1262 Score = 31.1 bits (67), Expect = 6.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPP P G PPP F Sbjct: 691 PPPPPPLPGEAGMP---PPPPPLPGGPGIPPPPPF 722 >BC063046-1|AAH63046.1| 306|Homo sapiens proline-rich transmembrane protein 1 protein. Length = 306 Score = 31.1 bits (67), Expect = 6.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PP + PPPPP PPPP Sbjct: 105 PRMPPDPYLQETRFEGPLPPPPPAAAAPPPP 135 >BC044591-1|AAH44591.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXX---PPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 325 PPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPP 359 >AY363395-1|AAQ63049.1| 1272|Homo sapiens diaphanous 1 protein. Length = 1272 Score = 31.1 bits (67), Expect = 6.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPP P G PPP F Sbjct: 701 PPPPPPLPGEAGMP---PPPPPLPGGPGIPPPPPF 732 >AY360322-1|AAQ64023.1| 179|Homo sapiens diaphanous 1 protein. Length = 179 Score = 31.1 bits (67), Expect = 6.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPP P G PPP F Sbjct: 85 PPPPPPLPGEAGMP---PPPPPLPGGPGIPPPPPF 116 >AL845464-1|CAI41794.2| 306|Homo sapiens proline-rich transmembrane protein 1 protein. Length = 306 Score = 31.1 bits (67), Expect = 6.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PP + PPPPP PPPP Sbjct: 105 PRMPPDPYLQETRFEGPLPPPPPAAAAPPPP 135 >AL662884-7|CAI18339.2| 306|Homo sapiens proline-rich transmembrane protein 1 protein. Length = 306 Score = 31.1 bits (67), Expect = 6.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PP + PPPPP PPPP Sbjct: 105 PRMPPDPYLQETRFEGPLPPPPPAAAAPPPP 135 >AL662828-7|CAI17422.2| 306|Homo sapiens proline-rich transmembrane protein 1 protein. Length = 306 Score = 31.1 bits (67), Expect = 6.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PP + PPPPP PPPP Sbjct: 105 PRMPPDPYLQETRFEGPLPPPPPAAAAPPPP 135 >AL590009-1|CAI12485.1| 559|Homo sapiens WAS protein family, member 1 protein. Length = 559 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXX---PPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 325 PPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPP 359 >AK054885-1|BAB70821.1| 306|Homo sapiens protein ( Homo sapiens cDNA FLJ30323 fis, clone BRACE2007109, highly similar to Extensin-like protein NG5. ). Length = 306 Score = 31.1 bits (67), Expect = 6.7 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 420 PPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 P PP + PPPPP PPPP Sbjct: 105 PRMPPDPYLQETRFEGPLPPPPPAAAAPPPP 135 >AF134303-1|AAD33052.1| 559|Homo sapiens Scar1 protein. Length = 559 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/35 (40%), Positives = 15/35 (42%), Gaps = 3/35 (8%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXX---PPPPPXXXGPPPP 512 PPPPPP + PPPP PPPP Sbjct: 325 PPPPPPLPSALSTSSLRASMTSTPPPPVPPPPPPP 359 >AB209482-1|BAD92719.1| 1299|Homo sapiens Diaphanous 1 variant protein. Length = 1299 Score = 31.1 bits (67), Expect = 6.7 Identities = 15/35 (42%), Positives = 15/35 (42%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPPXXF 521 PPPPPP PPP P G PPP F Sbjct: 728 PPPPPPLPGEAGMP---PPPPPLPGGPGIPPPPPF 759 >AB084087-1|BAC67014.1| 1422|Homo sapiens Formactin2 protein. Length = 1422 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPP Sbjct: 829 PPPPPPPTF-----LGLPPPPPPPLLDSIPPP 855 >AB051482-1|BAB21786.1| 1199|Homo sapiens KIAA1695 protein protein. Length = 1199 Score = 31.1 bits (67), Expect = 6.7 Identities = 14/32 (43%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP + PPPPP PPP Sbjct: 606 PPPPPPPTF-----LGLPPPPPPPLLDSIPPP 632 >AB022660-1|BAA82444.1| 1542|Homo sapiens SET-binding protein (SEB) protein. Length = 1542 Score = 31.1 bits (67), Expect = 6.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 1469 PPPPPP-----------PLPPPPPPPLPPPPP 1489 >AB007897-1|BAA24826.2| 1605|Homo sapiens KIAA0437 protein. Length = 1605 Score = 31.1 bits (67), Expect = 6.7 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 1532 PPPPPP-----------PLPPPPPPPLPPPPP 1552 >Y00970-1|CAA68784.1| 421|Homo sapiens protein ( Human mRNA for acrosin (EC 3.4.21.10). ). Length = 421 Score = 30.7 bits (66), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +P PP P PPPPP PPPP Sbjct: 333 RPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPP 365 >X66188-1|CAA46956.1| 421|Homo sapiens proacrosin protein. Length = 421 Score = 30.7 bits (66), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +P PP P PPPPP PPPP Sbjct: 333 RPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPP 365 >X54017-1|CAA37964.1| 421|Homo sapiens preproacrosin protein. Length = 421 Score = 30.7 bits (66), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +P PP P PPPPP PPPP Sbjct: 333 RPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPP 365 >M77381-1|AAA51575.1| 184|Homo sapiens acrosin protein. Length = 184 Score = 30.7 bits (66), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +P PP P PPPPP PPPP Sbjct: 96 RPLPPRPPAAQPPPPPSPPPPPPPPASPLPPPP 128 >CR456366-1|CAG30252.1| 421|Homo sapiens ACR protein. Length = 421 Score = 30.7 bits (66), Expect = 8.9 Identities = 13/33 (39%), Positives = 14/33 (42%) Frame = +3 Query: 414 KPPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 +P PP P PPPPP PPPP Sbjct: 333 RPLPPRPPAAQPRPPPSPPPPPPPPASPLPPPP 365 >AY494951-1|AAS82582.1| 1250|Homo sapiens lamellipodin protein. Length = 1250 Score = 30.7 bits (66), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 629 PPPPPPP------------PPPPPPPPPPPPP 648 >AY260762-1|AAP20225.1| 3567|Homo sapiens zinc finger homeodomain 4 protein protein. Length = 3567 Score = 30.7 bits (66), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 1997 PPPPPPP------------PPPPPPPPPPPPP 2016 >AL353637-4|CAH70683.1| 432|Homo sapiens forkhead box B2 protein. Length = 432 Score = 30.7 bits (66), Expect = 8.9 Identities = 12/31 (38%), Positives = 13/31 (41%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPP 509 PPPPPP + P PPP PP Sbjct: 169 PPPPPPHMVHYFHQQPPTAPQPPPHLPSQPP 199 >AK097947-1|BAC05201.1| 209|Homo sapiens protein ( Homo sapiens cDNA FLJ40628 fis, clone THYMU2014204, weakly similar to WISKOTT-ALDRICH SYNDROME PROTEIN. ). Length = 209 Score = 30.7 bits (66), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 65 PPPPPPP------------PPPPPPPPPPPPP 84 >AJ584699-1|CAE48361.1| 1250|Homo sapiens RAPH1 protein protein. Length = 1250 Score = 30.7 bits (66), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 629 PPPPPPP------------PPPPPPPPPPPPP 648 >AB075851-1|BAB85557.1| 830|Homo sapiens KIAA1971 protein protein. Length = 830 Score = 30.7 bits (66), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 660 PPPPPPP------------PPPPPPPPPPPPP 679 >AB051468-1|BAB21772.1| 1236|Homo sapiens KIAA1681 protein protein. Length = 1236 Score = 30.7 bits (66), Expect = 8.9 Identities = 15/32 (46%), Positives = 15/32 (46%) Frame = +3 Query: 417 PPPPPPXXXXXXKKIXKXXPPPPPXXXGPPPP 512 PPPPPP PPPPP PPPP Sbjct: 615 PPPPPPP------------PPPPPPPPPPPPP 634 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 89,156,771 Number of Sequences: 237096 Number of extensions: 1885574 Number of successful extensions: 22023 Number of sequences better than 10.0: 158 Number of HSP's better than 10.0 without gapping: 5453 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 14580 length of database: 76,859,062 effective HSP length: 91 effective length of database: 55,283,326 effective search space used: 13710264848 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -