BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_E07 (850 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S... 218 3e-57 At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) str... 218 4e-57 At2g43680.2 68415.m05430 calmodulin-binding family protein simil... 30 1.7 At2g43680.1 68415.m05429 calmodulin-binding family protein simil... 30 1.7 At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp... 29 3.9 At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp... 29 3.9 At4g39500.1 68417.m05586 cytochrome P450, putative simialrity to... 29 3.9 At4g39480.1 68417.m05585 cytochrome P450 family protein contains... 28 6.8 At1g26400.1 68414.m03220 FAD-binding domain-containing protein s... 28 6.8 At1g18670.1 68414.m02330 protein kinase family protein contains ... 28 6.8 At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/pr... 28 9.0 At5g01010.1 68418.m00001 expressed protein 28 9.0 At1g57750.1 68414.m06552 cytochrome P450, putative similar to cy... 28 9.0 >At5g02870.1 68418.m00230 60S ribosomal protein L4/L1 (RPL4D) 60S roibosomal protein L4, Arabidopsis thaliana, EMBL:CAA79104 Length = 407 Score = 218 bits (533), Expect = 3e-57 Identities = 108/203 (53%), Positives = 127/203 (62%) Frame = +3 Query: 174 LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAVARIPRVRGGG 353 LP V AP+RPD+VN VH +S NSRQPY VSK+AGHQTSAESWGTGRAV+RIPRV GGG Sbjct: 30 LPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTSAESWGTGRAVSRIPRVPGGG 89 Query: 354 THRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXXXXXXXXXXXXXXXXXQARGHI 533 THR+GQ AFGNMCRGGRMFAPTK WRRWH ARGH Sbjct: 90 THRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVNMKRHAIVSAIAATAVPALVMARGHK 149 Query: 534 IEKIPELPLVVADKVQEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRNRPSYP 713 IE +PE+PLVV+D + + KT A+ L+++ A+ D K S +R GKGKMRNR Sbjct: 150 IENVPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYIS 209 Query: 714 A*GXPHNLQTRIRV*LXPFRNIP 782 G T + FRN+P Sbjct: 210 RKGPLVVFGTEGAKIVKAFRNLP 232 >At3g09630.1 68416.m01142 60S ribosomal protein L4/L1 (RPL4A) strong similarity to 60S ribosomal protein L1 GB:P49691 Length = 406 Score = 218 bits (532), Expect = 4e-57 Identities = 108/203 (53%), Positives = 127/203 (62%) Frame = +3 Query: 174 LPFVFKAPIRPDLVNDVHVSMSKNSRQPYCVSKEAGHQTSAESWGTGRAVARIPRVRGGG 353 LP V AP+RPD+VN VH +S NSRQPY VSK+AGHQTSAESWGTGRAV+RIPRV GGG Sbjct: 29 LPDVMTAPVRPDIVNFVHAQISNNSRQPYAVSKKAGHQTSAESWGTGRAVSRIPRVPGGG 88 Query: 354 THRSGQGAFGNMCRGGRMFAPTKPWRRWHXXXXXXXXXXXXXXXXXXXXXXXXXQARGHI 533 THR+GQ AFGNMCRGGRMFAPTK WRRWH ARGH Sbjct: 89 THRAGQAAFGNMCRGGRMFAPTKIWRRWHRRVNVNMKRHAIVSAIAATAVPALVMARGHK 148 Query: 534 IEKIPELPLVVADKVQEINKTKQAVIFLRRLKAWSDILKVYKSQRLRAGKGKMRNRPSYP 713 IE +PE+PLVV+D + + KT A+ L+++ A+ D K S +R GKGKMRNR Sbjct: 149 IENVPEMPLVVSDSAEAVEKTSAAIKVLKQIGAYDDAEKAKNSIGIRPGKGKMRNRRYIS 208 Query: 714 A*GXPHNLQTRIRV*LXPFRNIP 782 G T + FRN+P Sbjct: 209 RKGPLVVYGTEGSKIVKAFRNLP 231 >At2g43680.2 68415.m05430 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 669 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +2 Query: 395 WWTYVRPHEALAALAPSRQPPTAESGLGGSRCCYRRPSARSG*RTHY*KDSRASLGCSRQ 574 WW +V LA+ APS P + L SR C P ++S + H D+ R Sbjct: 465 WWNWVDRQNPLASPAPSYSQPQRDFRLTPSRLC-PSPLSQSSKQHHIRLDNHFDTSTPRS 523 Query: 575 S 577 S Sbjct: 524 S 524 >At2g43680.1 68415.m05429 calmodulin-binding family protein similar to SF16 protein [Helianthus annuus] GI:560150; contains Pfam profile PF00612: IQ calmodulin-binding motif Length = 668 Score = 30.3 bits (65), Expect = 1.7 Identities = 19/61 (31%), Positives = 26/61 (42%) Frame = +2 Query: 395 WWTYVRPHEALAALAPSRQPPTAESGLGGSRCCYRRPSARSG*RTHY*KDSRASLGCSRQ 574 WW +V LA+ APS P + L SR C P ++S + H D+ R Sbjct: 464 WWNWVDRQNPLASPAPSYSQPQRDFRLTPSRLC-PSPLSQSSKQHHIRLDNHFDTSTPRS 522 Query: 575 S 577 S Sbjct: 523 S 523 >At5g55100.2 68418.m06869 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 844 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 411 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 292 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At5g55100.1 68418.m06868 SWAP (Suppressor-of-White-APricot)/surp domain-containing protein contains Pfam domain PF01805: Surp module Length = 843 Score = 29.1 bits (62), Expect = 3.9 Identities = 12/41 (29%), Positives = 21/41 (51%), Gaps = 1/41 (2%) Frame = -2 Query: 411 RTYVHHDTCYRRHPDRTY-EYHHHGHAEFGRQHVQYPMIQH 292 R++ H + +H D + E+HHH H R+H ++H Sbjct: 735 RSHHHRSRKHEKHRDSSDDEHHHHRHRSSRRKHEDSSDVEH 775 >At4g39500.1 68417.m05586 cytochrome P450, putative simialrity to cytochrome P450 CYP86A1, Arabidopsis thaliana, EMBL:X90458 Length = 469 Score = 29.1 bits (62), Expect = 3.9 Identities = 16/47 (34%), Positives = 26/47 (55%), Gaps = 1/47 (2%) Frame = +3 Query: 573 KVQEINKTKQAVIFLRRLKA-WSDILKVYKSQRLRAGKGKMRNRPSY 710 KVQ +K + L R++A W D +K +R + KG +R+ PS+ Sbjct: 356 KVQANSKIIICLYALGRMRAVWGDDALEFKPERWVSDKGSLRHEPSF 402 >At4g39480.1 68417.m05585 cytochrome P450 family protein contains Pfam profile: PF00067 cytochrome P450 Length = 989 Score = 28.3 bits (60), Expect = 6.8 Identities = 12/32 (37%), Positives = 20/32 (62%) Frame = +3 Query: 171 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 266 P+PF K+P +PD++ H + NSR +C+ Sbjct: 384 PVPFNHKSPAKPDVLPSGH-KVKANSRILFCL 414 >At1g26400.1 68414.m03220 FAD-binding domain-containing protein similar to SP|P30986 reticuline oxidase precursor (Berberine-bridge-forming enzyme) (BBE) (Tetrahydroprotoberberine synthase) [Eschscholzia californica]; contains PF01565 FAD binding domain Length = 527 Score = 28.3 bits (60), Expect = 6.8 Identities = 13/22 (59%), Positives = 16/22 (72%) Frame = -1 Query: 601 CLVLLISWTLSATTKGSSGIFS 536 CLVLL+S +A TK SGIF+ Sbjct: 9 CLVLLVSILRAAVTKPDSGIFT 30 >At1g18670.1 68414.m02330 protein kinase family protein contains Protein kinases ATP-binding region signature, PROSITE:PS00107 and Serine/Threonine protein kinases active-site signature, PROSITE:PS00108 Length = 662 Score = 28.3 bits (60), Expect = 6.8 Identities = 18/54 (33%), Positives = 26/54 (48%) Frame = +2 Query: 512 RSG*RTHY*KDSRASLGCSRQSPRDQQDQTGCHLPEAPQGMV*YP*GVQVSASS 673 R+G H DS ++L Q P + + H+ A QG V + +QVS SS Sbjct: 491 RNGHSVHNSIDSDSTLFEKMQKPSNHEKDEASHVKNASQGDVPFSGPLQVSVSS 544 >At5g17650.1 68418.m02069 glycine/proline-rich protein glycine/proline-rich protein GPRP - Arabidopsis thaliana, EMBL:X84315 Length = 173 Score = 27.9 bits (59), Expect = 9.0 Identities = 10/24 (41%), Positives = 12/24 (50%) Frame = -2 Query: 399 HHDTCYRRHPDRTYEYHHHGHAEF 328 HH Y H Y Y +HGH +F Sbjct: 122 HHHGHYGHHHGHGYGYGYHGHGKF 145 >At5g01010.1 68418.m00001 expressed protein Length = 409 Score = 27.9 bits (59), Expect = 9.0 Identities = 16/45 (35%), Positives = 28/45 (62%), Gaps = 1/45 (2%) Frame = -3 Query: 296 STGLVTSLLAHAVGLPRVLGHRNVNIIDQVR-TDGRLEHEREGLG 165 +TG+ +L+ + VG+P+VL ++ I Q+ DG +E +RE G Sbjct: 203 ATGVYKTLVKYLVGVPQVL----LDFIRQINDDDGPMEEQRERYG 243 >At1g57750.1 68414.m06552 cytochrome P450, putative similar to cytochrome P450 GI:4688670 from [Catharanthus roseus] Length = 497 Score = 27.9 bits (59), Expect = 9.0 Identities = 12/32 (37%), Positives = 19/32 (59%) Frame = +3 Query: 171 PLPFVFKAPIRPDLVNDVHVSMSKNSRQPYCV 266 PLPF K+P +PD++ H + NS+ C+ Sbjct: 367 PLPFNHKSPAKPDVLPSGH-KVDANSKIVICI 397 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,630,771 Number of Sequences: 28952 Number of extensions: 354808 Number of successful extensions: 1119 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 1039 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1105 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1970388800 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -