BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_E05 (889 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g05130.1 68418.m00544 SNF2 domain-containing protein / helica... 31 1.4 At3g55220.1 68416.m06133 splicing factor, putative contains CPSF... 28 7.2 At3g55200.1 68416.m06131 splicing factor, putative contains CPSF... 28 7.2 At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family pr... 28 9.5 At3g24540.1 68416.m03082 protein kinase family protein contains ... 28 9.5 >At5g05130.1 68418.m00544 SNF2 domain-containing protein / helicase domain-containing protein / RING finger domain-containing protein similar to transcription factor RUSH-1alpha [Oryctolagus cuniculus] GI:1655930; contains Pfam profiles PF00271: Helicase conserved C-terminal domain, PF00176: SNF2 family N-terminal domain, PF00097: Zinc finger, C3HC4 type (RING finger) Length = 862 Score = 30.7 bits (66), Expect = 1.4 Identities = 13/58 (22%), Positives = 32/58 (55%), Gaps = 1/58 (1%) Frame = -3 Query: 188 LKCRVRLTTILESGGESRSYVARSESIM-RDSDVAFSHSAALAIAQVRRNGNKNNISR 18 + C++ + LE+ +S ++R ++ +SD +F S A+ + + NG+K ++ + Sbjct: 126 IPCQIHVFAKLEASSTVKSTISRGGLVLISESDTSFGLSEAVVVKEQMGNGDKRSVDK 183 >At3g55220.1 68416.m06133 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 391 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 302 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At3g55200.1 68416.m06131 splicing factor, putative contains CPSF A subunit region (PF03178); contains weak WD-40 repeat (PF00400); similar to Splicing factor 3B subunit 3 (SF3b130)/spliceosomal protein/Splicing factor 3B subunit 3 (SAP 130)(KIAA0017)(SP:Q15393) Homo sapiens, EMBL:HSAJ1443_1 Length = 1214 Score = 28.3 bits (60), Expect = 7.2 Identities = 13/30 (43%), Positives = 18/30 (60%) Frame = -1 Query: 391 GRGERSPRRWLQPRLAVPRQASTSVPRTPA 302 GRG RS R L+P LA+ A + +P P+ Sbjct: 426 GRGPRSSLRILRPGLAITEMAVSQLPGQPS 455 >At4g02590.1 68417.m00353 basic helix-loop-helix (bHLH) family protein similar to A. thaliana putative protein F6I18.110, GenBank accession number 2980768 Length = 310 Score = 27.9 bits (59), Expect = 9.5 Identities = 15/38 (39%), Positives = 18/38 (47%) Frame = -2 Query: 213 LGLTNVSMSQMQGQVDYDFGVGGGVPIVRCEERVDHEG 100 LGL N S S G D G+GGG P + + EG Sbjct: 24 LGLPNFSASSAAGLSGVDGGLGGGAPPMMLQLGSGEEG 61 >At3g24540.1 68416.m03082 protein kinase family protein contains protein kinase domain, Pfam:PF00069 Length = 509 Score = 27.9 bits (59), Expect = 9.5 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +3 Query: 120 PRNVRSGLPPRLQNRSQPDPA 182 PR+ + PPRL NR+ P PA Sbjct: 75 PRSPSTSTPPRLGNRNPPPPA 95 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,557,329 Number of Sequences: 28952 Number of extensions: 357165 Number of successful extensions: 1089 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 1035 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1083 length of database: 12,070,560 effective HSP length: 81 effective length of database: 9,725,448 effective search space used: 2081245872 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -