BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_E02 (849 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 06_03_1310 + 29238644-29240260 36 0.031 01_01_0448 - 3332238-3332330,3332414-3332481,3332570-3332618,333... 33 0.38 07_01_0373 + 2783596-2784933 31 0.88 04_04_0316 - 24338774-24339367 31 1.2 09_06_0277 - 21983049-21983080,21983250-21984788,21986619-219866... 30 2.0 02_01_0219 - 1437685-1437723,1437932-1438091,1438385-1438514,143... 29 3.5 04_01_0041 - 464695-464850,467485-469029 29 6.2 02_05_0158 - 26362259-26362695,26363732-26363903 29 6.2 02_02_0369 - 9505330-9505652,9507262-9507532,9507649-9507690,950... 29 6.2 01_05_0227 - 19512866-19514983 29 6.2 11_04_0307 + 16185405-16185713,16185847-16185942,16186626-161867... 28 8.2 08_02_1615 + 28257275-28258428,28258523-28259144 28 8.2 03_05_0824 + 27980191-27980243,27980633-27980671,27980974-279820... 28 8.2 02_05_0788 + 31758119-31758384,31758482-31758634,31759385-317595... 28 8.2 >06_03_1310 + 29238644-29240260 Length = 538 Score = 36.3 bits (80), Expect = 0.031 Identities = 22/61 (36%), Positives = 29/61 (47%), Gaps = 1/61 (1%) Frame = +3 Query: 573 HQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPGLKPPLSSEAPSAYLTPS-SLGMAKGVSP 749 H+ P H PP+ P P P +P P PP SE+P + + PS S + G SP Sbjct: 381 HRSPLPHHMPPRRTPPTPPPPSSPTPSHLPP--PPPTYSESPKSSMPPSTSPPSSHGASP 438 Query: 750 P 752 P Sbjct: 439 P 439 >01_01_0448 - 3332238-3332330,3332414-3332481,3332570-3332618, 3332716-3332798,3332900-3333023,3333389-3333486, 3333555-3333634,3333712-3333782,3333872-3333953, 3334158-3334237,3334365-3334416,3334843-3334958 Length = 331 Score = 32.7 bits (71), Expect = 0.38 Identities = 20/57 (35%), Positives = 30/57 (52%) Frame = +2 Query: 545 LAISATSTRSSNPRFHTPTTPDLTSISINPLNAVLXGVRAGVKASVVIRGSISVSHP 715 +A S+T+TR S PR H PTTP S + + +RA +V+ G+ + HP Sbjct: 1 MAASSTATRLSPPRLHAPTTP---SPHLPLRRSRFSPLRAAKLEAVLTIGTHLIPHP 54 >07_01_0373 + 2783596-2784933 Length = 445 Score = 31.5 bits (68), Expect = 0.88 Identities = 12/28 (42%), Positives = 21/28 (75%) Frame = -1 Query: 93 EEEKALTKEGMAEAAETXKGTISSMNRS 10 E+++ LTK G + +ET KG++ S++RS Sbjct: 151 EQQQQLTKSGCSSTSETSKGSVLSLSRS 178 >04_04_0316 - 24338774-24339367 Length = 197 Score = 31.1 bits (67), Expect = 1.2 Identities = 22/67 (32%), Positives = 30/67 (44%) Frame = +3 Query: 540 LPWRSRLHQPDHQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPGLKPPLSSEAPSAYLTPS 719 LPWR+R QP +P+ + PPQ S + + + AP L EA L P Sbjct: 101 LPWRARPQQP---LPEEQNPPPQETSASSSSSSSTHVR-IAPEEPGDLDLEAQDQLLPPP 156 Query: 720 SLGMAKG 740 + G KG Sbjct: 157 ATGSPKG 163 >09_06_0277 - 21983049-21983080,21983250-21984788,21986619-21986655, 21987612-21987665,21987781-21987893,21988272-21988660, 21988783-21988903,21989245-21989342,21989963-21990153 Length = 857 Score = 30.3 bits (65), Expect = 2.0 Identities = 20/61 (32%), Positives = 29/61 (47%), Gaps = 2/61 (3%) Frame = +3 Query: 540 LPWRSRLHQPDHQIPDSIHQPPQT*HPFPSIP-*TPYXKEFA-PGLKPPLSSEAPSAYLT 713 LP R+R+ +PD + D + + P+ S P PY F+ P PP +PS L Sbjct: 332 LPARARVLRPDELLLDHYYYHSSSSDPYYSTPILPPYGDAFSPPNPPPPPPPMSPSCLLP 391 Query: 714 P 716 P Sbjct: 392 P 392 >02_01_0219 - 1437685-1437723,1437932-1438091,1438385-1438514, 1438627-1438696,1439264-1439407,1439771-1439837, 1439970-1440019,1440386-1440559,1440881-1440934, 1441008-1441112 Length = 330 Score = 29.5 bits (63), Expect = 3.5 Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 2/85 (2%) Frame = +3 Query: 285 TETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSL--KIPVTVDLCWTTADVT 458 TE +N V V L SS GY D + ++ V + K+ V +D TAD++ Sbjct: 167 TEAGANRVLVCDLH--SSQAMGYFDIPVDHVYGQVMNLIGDVRGKVAVMMDDMIDTADIS 224 Query: 459 VEGVNVLATPSSSRITIGGLALMHQ 533 + +N+L P G L+HQ Sbjct: 225 LPNINILMKPIKLGTIAKGAELLHQ 249 >04_01_0041 - 464695-464850,467485-469029 Length = 566 Score = 28.7 bits (61), Expect = 6.2 Identities = 18/63 (28%), Positives = 32/63 (50%), Gaps = 1/63 (1%) Frame = +3 Query: 246 IIPFQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPS-APSLKIPV 422 +I R + D++ T +SN + V +LP VSS + Y D ++ + P P ++ V Sbjct: 40 LISVFRPFTDVSLTLCRSNYIGVTNLPIVSSECEAYYDDFVSGADFTARPQVVPPWRLAV 99 Query: 423 TVD 431 +D Sbjct: 100 PLD 102 >02_05_0158 - 26362259-26362695,26363732-26363903 Length = 202 Score = 28.7 bits (61), Expect = 6.2 Identities = 16/34 (47%), Positives = 22/34 (64%), Gaps = 1/34 (2%) Frame = +2 Query: 521 PYASSHPPLAISATSTRSSNPRFHTP-TTPDLTS 619 P ASS PP + + +T SS+P TP +TPD T+ Sbjct: 132 PTASSSPP-STATPATPSSDPGMDTPSSTPDATT 164 >02_02_0369 - 9505330-9505652,9507262-9507532,9507649-9507690, 9508416-9508458,9508853-9508860 Length = 228 Score = 28.7 bits (61), Expect = 6.2 Identities = 17/47 (36%), Positives = 18/47 (38%), Gaps = 2/47 (4%) Frame = +3 Query: 618 PFPSIP*TPYXKEFAPGLKPPLSSEAPSAYLT--PSSLGMAKGVSPP 752 P P P P APG P S P+ Y T P G G PP Sbjct: 158 PLPRPPTLPPPTSGAPGAPIPNSGAPPAMYQTNPPQPAGPTSGAPPP 204 >01_05_0227 - 19512866-19514983 Length = 705 Score = 28.7 bits (61), Expect = 6.2 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 463 STVTSAVVQQRSTVTGILRLGAEGKTTASRL 371 S +T + +QQ + ++ LG GKTT ++L Sbjct: 18 SKLTESSIQQNIKIVSVIGLGGSGKTTLAKL 48 >11_04_0307 + 16185405-16185713,16185847-16185942,16186626-16186730, 16186938-16187090,16188395-16188478,16188566-16188694, 16188986-16189165,16189555-16189677,16189678-16189794, 16189889-16190053 Length = 486 Score = 28.3 bits (60), Expect = 8.2 Identities = 16/49 (32%), Positives = 21/49 (42%) Frame = +3 Query: 600 PPQT*HPFPSIP*TPYXKEFAPGLKPPLSSEAPSAYLTPSSLGMAKGVS 746 PP + P P +P PY + +P PP P + P S A G S Sbjct: 22 PPSSSSPSPPVPPDPYGADLSP---PPPPPPKPPPTVPPPSYEQAVGSS 67 >08_02_1615 + 28257275-28258428,28258523-28259144 Length = 591 Score = 28.3 bits (60), Expect = 8.2 Identities = 19/62 (30%), Positives = 24/62 (38%) Frame = +3 Query: 564 QPDHQIPDSIHQPPQT*HPFPSIP*TPYXKEFAPGLKPPLSSEAPSAYLTPSSLGMAKGV 743 QP H H PQ+ HP P P AP PP S P ++ + L K + Sbjct: 32 QPPHSHLLHHHHSPQS-HPQPDAPAAAAPPPPAPLTPPPPKSPPPPPHIQTTDLPPPKPL 90 Query: 744 SP 749 P Sbjct: 91 PP 92 >03_05_0824 + 27980191-27980243,27980633-27980671,27980974-27982023, 27983097-27983262,27983439-27983549,27983637-27983688, 27984691-27984859,27985604-27985883 Length = 639 Score = 28.3 bits (60), Expect = 8.2 Identities = 21/60 (35%), Positives = 32/60 (53%), Gaps = 4/60 (6%) Frame = +3 Query: 402 PSLKIPVTVDL--CWTTADVTVEGVNVLATPSSSRITIGGLALMHQATLPWRSR--LHQP 569 P KIP +++ C T+ D T ++ S+ +ITIG L L+ + WR R LH+P Sbjct: 220 PGSKIPCNLEVSDCLTSHDGTSA-----SSSSNEKITIGLLFLLQKLCKNWRLRRFLHRP 274 >02_05_0788 + 31758119-31758384,31758482-31758634,31759385-31759509, 31759650-31759678,31760943-31761008,31761059-31761125, 31761226-31761370,31761404-31761451,31762014-31762182, 31762645-31762779,31762858-31763064,31763608-31763735, 31763815-31763866,31764046-31764060,31764502-31764609 Length = 570 Score = 28.3 bits (60), Expect = 8.2 Identities = 21/86 (24%), Positives = 36/86 (41%) Frame = +3 Query: 237 QRLIIPFQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRDAYLVNLEAVVFPSAPSLKI 416 Q I + ++ L N TV + N + GY+ +N+ + PSLK Sbjct: 198 QVFCIVLEMFFYQLLQLLKVPNEKTVNVIENAIQTLPGYQPPKHINIGEYISSHVPSLK- 256 Query: 417 PVTVDLCWTTADVTVEGVNVLATPSS 494 D C T ++ +EG++ L S+ Sbjct: 257 ----DFCEPTVEM-LEGMSALKALST 277 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,575,522 Number of Sequences: 37544 Number of extensions: 501793 Number of successful extensions: 1545 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 1460 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1543 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2362209084 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -