BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_E01 (830 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 10_08_0996 - 22112020-22112859 29 4.5 03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399 29 4.5 03_05_0183 - 21681673-21682524 29 4.5 01_06_1406 - 37073548-37073822,37073892-37074111,37074200-370742... 29 6.0 03_02_0740 - 10836752-10837052,10837756-10837814,10837901-108384... 28 7.9 01_07_0101 + 41086735-41086809,41088634-41088721,41089727-410899... 28 7.9 01_06_0456 + 29521282-29522064 28 7.9 >10_08_0996 - 22112020-22112859 Length = 279 Score = 29.1 bits (62), Expect = 4.5 Identities = 15/40 (37%), Positives = 20/40 (50%) Frame = +1 Query: 709 QKKLPQGITGLVAAQAFIATLLFDPSXSALPIIAXQNRQA 828 QK + AQAF A LL D + +A P++ Q R A Sbjct: 212 QKHAATAEAEIAEAQAFSAVLLADANRTASPVVVVQKRAA 251 >03_05_1067 - 30105850-30106034,30106036-30106192,30106301-30106399 Length = 146 Score = 29.1 bits (62), Expect = 4.5 Identities = 21/67 (31%), Positives = 30/67 (44%) Frame = +2 Query: 416 RTVFRSKRAEW*RGGNARRRLKLPRDPVRGHCQAGSLTGAVHLSKNNAGVLRPAQRGQKP 595 R + +R E G +RR L D +RG+ + A H AG + RG KP Sbjct: 59 RCIAEGRREEEEEVGRSRRGKDLDLDDMRGYGET-----ATHHGLRLAGREEVSPRGGKP 113 Query: 596 RVEQKGK 616 RV+ G+ Sbjct: 114 RVDNGGR 120 >03_05_0183 - 21681673-21682524 Length = 283 Score = 29.1 bits (62), Expect = 4.5 Identities = 12/30 (40%), Positives = 19/30 (63%) Frame = +1 Query: 739 LVAAQAFIATLLFDPSXSALPIIAXQNRQA 828 + +QAF A LL D + +A+P++ Q R A Sbjct: 226 IAESQAFSAVLLADANRAAIPVVVVQKRPA 255 >01_06_1406 - 37073548-37073822,37073892-37074111,37074200-37074246, 37074404-37074576,37075161-37075238,37075751-37075813, 37075889-37075961,37076150-37076189,37076302-37076368, 37076719-37078472,37079128-37079230,37080041-37080078, 37080221-37080347,37081944-37082152 Length = 1088 Score = 28.7 bits (61), Expect = 6.0 Identities = 14/30 (46%), Positives = 18/30 (60%) Frame = +1 Query: 457 RKRSSPFKTPA*SGSRTLPGGEFDWGGTSV 546 +KR P K PA S S+ LPG + + G SV Sbjct: 339 KKRGRPRKYPAPSNSKHLPGTDTELGNDSV 368 >03_02_0740 - 10836752-10837052,10837756-10837814,10837901-10838476, 10839965-10841686,10841776-10842173,10842264-10842318, 10842989-10843048,10843444-10843540,10844885-10844955, 10845029-10845109,10846054-10846124,10847951-10848119, 10848521-10848683,10848752-10848942,10849037-10849168 Length = 1381 Score = 28.3 bits (60), Expect = 7.9 Identities = 12/24 (50%), Positives = 16/24 (66%) Frame = -1 Query: 536 PPQSNSPPGSVLEPDHAGVLNGDE 465 P +NS P +V +PD +LNGDE Sbjct: 739 PTSNNSVPQNVDQPDSKKMLNGDE 762 >01_07_0101 + 41086735-41086809,41088634-41088721,41089727-41089923, 41090077-41090266,41090469-41090860,41091390-41091965 Length = 505 Score = 28.3 bits (60), Expect = 7.9 Identities = 13/27 (48%), Positives = 14/27 (51%) Frame = -3 Query: 474 RRRAFPPRHHSARLERNTVRSSKPEFS 394 RR P HHS L R RSS+ E S Sbjct: 406 RRSVRSPNHHSPDLRREAARSSRAEVS 432 >01_06_0456 + 29521282-29522064 Length = 260 Score = 28.3 bits (60), Expect = 7.9 Identities = 14/32 (43%), Positives = 18/32 (56%), Gaps = 2/32 (6%) Frame = -3 Query: 516 AWQC--PRTGSRGSFKRRRAFPPRHHSARLER 427 AW+C P +G+RG +RRR P S R R Sbjct: 12 AWRCYSPASGARGGSRRRRRRPAGTTSRRCSR 43 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,094,041 Number of Sequences: 37544 Number of extensions: 529799 Number of successful extensions: 1307 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 1269 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1307 length of database: 14,793,348 effective HSP length: 81 effective length of database: 11,752,284 effective search space used: 2291695380 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -