BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_E01 (830 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AJ276485-1|CAB81951.1| 283|Homo sapiens integral membrane trans... 59 2e-08 BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MG... 46 1e-04 >AJ276485-1|CAB81951.1| 283|Homo sapiens integral membrane transporter protein protein. Length = 283 Score = 59.3 bits (137), Expect = 2e-08 Identities = 25/34 (73%), Positives = 29/34 (85%) Frame = +3 Query: 132 MVNYAWSGRSQGKP*WRTVAILTCKSIVGTGYRG 233 MVNYAW+GRSQ K WR+VA+LTCKS+V GYRG Sbjct: 1 MVNYAWAGRSQRKLWWRSVAVLTCKSVVRPGYRG 34 >BC114377-1|AAI14378.1| 44|Homo sapiens Unknown (protein for MGC:134704) protein. Length = 44 Score = 46.4 bits (105), Expect = 1e-04 Identities = 25/45 (55%), Positives = 29/45 (64%) Frame = -1 Query: 806 MIGRAXXEGSKSNVAMNAWAATSPVIPCGNFFWHLXLKTLYTKGS 672 MIGRA EGSKS+VAMNAW + PCGNF LK ++GS Sbjct: 1 MIGRADIEGSKSDVAMNAWPPQAS-YPCGNFSDTSCLKPKRSEGS 44 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 121,699,888 Number of Sequences: 237096 Number of extensions: 2903149 Number of successful extensions: 9341 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 9054 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 9338 length of database: 76,859,062 effective HSP length: 89 effective length of database: 55,757,518 effective search space used: 10426655866 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -