BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_E01 (830 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) ... 31 0.94 At3g16260.1 68416.m02051 metallo-beta-lactamase family protein 29 3.8 At1g77240.1 68414.m08996 AMP-binding protein, putative strong si... 29 5.0 At3g62370.1 68416.m07006 expressed protein 28 8.7 >At3g49600.1 68416.m05421 ubiquitin-specific protease 26 (UBP26) similar to GI:11993492; RNA binding protein - Homo sapiens, EMBL:AB016089 (N-terminus), several ubiquitin carboxyl-terminal hydrolases from aa pos. 712 Length = 1067 Score = 31.1 bits (67), Expect = 0.94 Identities = 14/35 (40%), Positives = 19/35 (54%) Frame = +2 Query: 140 LCLVRSKSGETLMEDRSDSDVQIDRRNWV*GRKTN 244 +C VR K M + SDS ++DRR R+TN Sbjct: 928 VCFVRGKEAPKAMLEASDSSFEVDRRTSKRSRRTN 962 >At3g16260.1 68416.m02051 metallo-beta-lactamase family protein Length = 937 Score = 29.1 bits (62), Expect = 3.8 Identities = 19/71 (26%), Positives = 31/71 (43%) Frame = -1 Query: 770 NVAMNAWAATSPVIPCGNFFWHLXLKTLYTKGSIGRAFAVPMRTEHXDQASFCPFAPREV 591 N +WA+ P N +L++KGS+ ++ + D +S PF + Sbjct: 693 NTTTTSWASVETSRPEKNTSSGNAEGSLFSKGSLMQSIYKRPSSPLTDNSSALPFLKKLK 752 Query: 590 SVLAELALGHL 558 VL E+ L HL Sbjct: 753 KVLGEMGLEHL 763 >At1g77240.1 68414.m08996 AMP-binding protein, putative strong similarity to AMP-binding protein GI:1903034 from [Brassica napus]; contains Pfam AMP-binding domain PF00501 Length = 545 Score = 28.7 bits (61), Expect = 5.0 Identities = 17/41 (41%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = -1 Query: 539 VPPQSNSPPGSVLE-PDHAGVLNGDE-RFRHVTTLHAWNET 423 +P SNS P +VL + A + GD H TT+H W+ET Sbjct: 5 LPHASNSCPLTVLGFLERAASVFGDSPSLLHTTTVHTWSET 45 >At3g62370.1 68416.m07006 expressed protein Length = 361 Score = 27.9 bits (59), Expect = 8.7 Identities = 13/34 (38%), Positives = 19/34 (55%), Gaps = 2/34 (5%) Frame = -1 Query: 524 NSPPGSVL--EPDHAGVLNGDERFRHVTTLHAWN 429 N+ PG + P G NG +RF H+ ++AWN Sbjct: 160 NAIPGRLYGGNPIDNGEGNGGDRFGHLVDIYAWN 193 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 18,101,897 Number of Sequences: 28952 Number of extensions: 403672 Number of successful extensions: 961 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 938 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 961 length of database: 12,070,560 effective HSP length: 80 effective length of database: 9,754,400 effective search space used: 1911862400 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -