BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_D23 (896 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 22 6.6 AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. 22 6.6 AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. 22 6.6 AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex det... 22 6.6 DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein ... 22 8.7 AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein ... 22 8.7 AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. 22 8.7 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = +3 Query: 456 SSLKNHYFHCFITYSVGRK 512 SS +FHC+ GRK Sbjct: 420 SSFFQQFFHCYCPVRFGRK 438 >AY569719-1|AAS86672.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 54 RTESCRSRTKRNRHD 10 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569718-1|AAS86671.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 54 RTESCRSRTKRNRHD 10 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569715-1|AAS86668.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 54 RTESCRSRTKRNRHD 10 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569714-1|AAS86667.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 54 RTESCRSRTKRNRHD 10 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569711-1|AAS86664.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 54 RTESCRSRTKRNRHD 10 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY569702-1|AAS86655.1| 400|Apis mellifera feminizer protein. Length = 400 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 54 RTESCRSRTKRNRHD 10 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >AY350616-1|AAQ57658.1| 401|Apis mellifera complementary sex determiner protein. Length = 401 Score = 22.2 bits (45), Expect = 6.6 Identities = 8/15 (53%), Positives = 11/15 (73%) Frame = -3 Query: 54 RTESCRSRTKRNRHD 10 RT SC SR + +RH+ Sbjct: 226 RTSSCHSRYEDSRHE 240 >DQ855482-1|ABH88169.1| 116|Apis mellifera chemosensory protein 1 protein. Length = 116 Score = 21.8 bits (44), Expect = 8.7 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +3 Query: 435 VGDRFARSSLKNHYFHCFI 491 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AJ973399-1|CAJ01446.1| 116|Apis mellifera hypothetical protein protein. Length = 116 Score = 21.8 bits (44), Expect = 8.7 Identities = 7/19 (36%), Positives = 11/19 (57%) Frame = +3 Query: 435 VGDRFARSSLKNHYFHCFI 491 + + A L+N Y+ CFI Sbjct: 32 IDEILANDRLRNQYYDCFI 50 >AB183889-1|BAD86829.1| 316|Apis mellifera Mos protein. Length = 316 Score = 21.8 bits (44), Expect = 8.7 Identities = 12/37 (32%), Positives = 19/37 (51%) Frame = -2 Query: 463 SDDRAKRSPTYATPLMSPYNARLESSSTGSSFPADSP 353 +D R SP TP+ + Y +E+ + S F D+P Sbjct: 21 NDKRIYLSPR--TPIKNVYKNNIETKNQLSPFNIDTP 55 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 209,820 Number of Sequences: 438 Number of extensions: 4921 Number of successful extensions: 16 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 58 effective length of database: 120,939 effective search space used: 29025360 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -