Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= BmNP01_FL5_D22
         (861 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro...    22   5.4  
AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.     21   9.5  

>DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein.
          Length = 2700

 Score = 22.2 bits (45), Expect = 5.4
 Identities = 7/15 (46%), Positives = 9/15 (60%)
 Frame = +2

Query: 254  CVSKEAGHQTSAESW 298
            C  K+ GH+ S  SW
Sbjct: 1152 CEEKKPGHKPSTSSW 1166


>AY884065-1|AAX84206.1|  697|Tribolium castaneum laccase 1 protein.
          Length = 697

 Score = 21.4 bits (43), Expect = 9.5
 Identities = 10/34 (29%), Positives = 13/34 (38%), Gaps = 3/34 (8%)
 Frame = -2

Query: 368 HPDRTYEYH---HHGHAEFGRQHVQYPMIQHWFG 276
           HP  T+ YH   H+    F   H  +      FG
Sbjct: 158 HPGMTFRYHFNVHNSGTHFWHSHSGFQRSDGTFG 191


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 192,280
Number of Sequences: 336
Number of extensions: 4105
Number of successful extensions: 4
Number of sequences better than 10.0: 2
Number of HSP's better than 10.0 without gapping: 4
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 4
length of database: 122,585
effective HSP length: 56
effective length of database: 103,769
effective search space used: 23866870
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)