BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_D21 (866 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_55186| Best HMM Match : TPR_2 (HMM E-Value=0.91) 103 2e-22 SB_46152| Best HMM Match : DUF241 (HMM E-Value=0.62) 32 0.70 SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.2 SB_51830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.1 SB_52798| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.7 SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) 29 4.9 SB_14131| Best HMM Match : TPR_2 (HMM E-Value=1.2) 29 4.9 >SB_55186| Best HMM Match : TPR_2 (HMM E-Value=0.91) Length = 571 Score = 103 bits (247), Expect = 2e-22 Identities = 71/214 (33%), Positives = 101/214 (47%), Gaps = 1/214 (0%) Frame = +1 Query: 7 VKKMSANKENNLVQAYLELNKFCQSSDYERALKAAGKILQIAPNEQKAFHCKVVCFLQLH 186 + KM+AN +L Q + EL++ + +Y +A K A KILQ +P ++ AFHCKVVC +Q Sbjct: 64 LSKMAANTSPSLPQLFSELDRLGKEGNYSKAQKIANKILQESPADEDAFHCKVVCLIQQS 123 Query: 187 NFKEALATLTNAKNSALAADLLFEKAYTQYRLNSPKEALQTVDSAPELTPALKELRAQIL 366 F EAL + + + L FEKAY YRLN +EA+QT+ + P+ P KEL AQ Sbjct: 124 YFHEALDVINSGSKKGIKV-LPFEKAYALYRLNMTQEAIQTLQALPDPGPKEKELLAQ-- 180 Query: 367 YRLEQYQDCYNLYRDLLKNTTDEYEDERKXXXXXXXXXXXXXXPTS-ELPQFDENTYELA 543 D+Y DER+ E E+TYEL+ Sbjct: 181 --------------------ADDYGDERETNMSAVIASSNQWGSVKLENVGLREHTYELS 220 Query: 544 YNSGSTLAMRGKYNEALSVLKRAEQACSXSVIXD 645 YN+ A+ L++AE C S+ D Sbjct: 221 YNAACLELANNNLEGAIKKLQQAEVLCRKSLEED 254 >SB_46152| Best HMM Match : DUF241 (HMM E-Value=0.62) Length = 1110 Score = 31.9 bits (69), Expect = 0.70 Identities = 23/82 (28%), Positives = 39/82 (47%), Gaps = 5/82 (6%) Frame = +1 Query: 223 KNSALAADLLFEKAYTQYRLNSPKEALQTVDSAP----ELTPALKELRAQILYRLEQYQD 390 KN L LF + T R N + +DS E+ AL++L + + E Q+ Sbjct: 692 KNDNLQTGNLFGETLTNLRENLSQTRQMVIDSRTQFKHEIVKALEKLSSTLKKASELTQE 751 Query: 391 CYNL-YRDLLKNTTDEYEDERK 453 + Y+ +L+ TD+Y+ E+K Sbjct: 752 RTSKEYKKILREVTDKYDKEKK 773 >SB_20424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1711 Score = 31.1 bits (67), Expect = 1.2 Identities = 26/84 (30%), Positives = 37/84 (44%) Frame = +1 Query: 190 FKEALATLTNAKNSALAADLLFEKAYTQYRLNSPKEALQTVDSAPELTPALKELRAQILY 369 +KE L LT + AA KA T Y N+ E + D + LK++RAQ L Sbjct: 1167 YKETLHELTKTQEELRAAS---SKAATGYE-NTISEIKKEKDMLYDEVKHLKDIRAQQLE 1222 Query: 370 RLEQYQDCYNLYRDLLKNTTDEYE 441 +E+ + RD+ N E E Sbjct: 1223 EIEELKRQIEHMRDVQNNYQKELE 1246 >SB_51830| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 582 Score = 30.3 bits (65), Expect = 2.1 Identities = 21/92 (22%), Positives = 43/92 (46%), Gaps = 6/92 (6%) Frame = +1 Query: 49 AYLELNKFCQSSDYERALKAAGKILQIAPNEQKA-----FHCKVVCFLQLHNFKEALATL 213 A L+ NK+ + YE+A+K + +++ P E K + + + Q++ F+ + Sbjct: 144 AKLKGNKYFKGCKYEQAIKCYTEAIELCPPENKQDLSTFYQNRAAAYEQMNQFENVVEEA 203 Query: 214 TNA-KNSALAADLLFEKAYTQYRLNSPKEALQ 306 T A + ++ L +A +L +E LQ Sbjct: 204 TKALELNSKYTKALMRRARALEKLERKQECLQ 235 >SB_52798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 29.5 bits (63), Expect = 3.7 Identities = 14/23 (60%), Positives = 17/23 (73%) Frame = -2 Query: 130 LSAVFSLQLLKLFHSHCSGKIYL 62 LSAV LQLL++FH+ C K YL Sbjct: 42 LSAVTPLQLLQVFHALCVSKGYL 64 >SB_21989| Best HMM Match : Spectrin (HMM E-Value=0) Length = 1805 Score = 29.1 bits (62), Expect = 4.9 Identities = 21/57 (36%), Positives = 28/57 (49%) Frame = +1 Query: 280 LNSPKEALQTVDSAPELTPALKELRAQILYRLEQYQDCYNLYRDLLKNTTDEYEDER 450 L P A V+ EL A+K + +I R Q + DLL N+TD+YE ER Sbjct: 1187 LKRPSTATSLVELDRELD-AVKRIGKEIDERKSQLE-LITRRGDLLANSTDQYESER 1241 >SB_14131| Best HMM Match : TPR_2 (HMM E-Value=1.2) Length = 144 Score = 29.1 bits (62), Expect = 4.9 Identities = 14/41 (34%), Positives = 21/41 (51%) Frame = +1 Query: 523 ENTYELAYNSGSTLAMRGKYNEALSVLKRAEQACSXSVIXD 645 E+TYEL+YN+ A+ L++AE C S+ D Sbjct: 59 EHTYELSYNAACLELANNNLEGAIKKLQQAEVLCRKSLEED 99 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.317 0.132 0.380 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 22,278,625 Number of Sequences: 59808 Number of extensions: 403717 Number of successful extensions: 934 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 850 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 933 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2479240863 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -