BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_D20 (849 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phospho... 24 5.1 AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein p... 24 6.7 >AY214334-1|AAP69612.1| 519|Anopheles gambiae nicotinate phosphoribosyltransferase-like protein protein. Length = 519 Score = 24.2 bits (50), Expect = 5.1 Identities = 14/46 (30%), Positives = 22/46 (47%), Gaps = 2/46 (4%) Frame = +1 Query: 667 PRGVPQIEVTFDIDANGILNVSAIXKSTNKE--NKIXITNDKGRLS 798 P G + T+D+ +G+LN A+ N + I I D G L+ Sbjct: 255 PDGFMALVDTYDVKRSGLLNFCAVALGLNDQGYRAIGIRIDSGDLA 300 >AJ439353-10|CAD27932.1| 3325|Anopheles gambiae F25C8.3 protein protein. Length = 3325 Score = 23.8 bits (49), Expect = 6.7 Identities = 9/23 (39%), Positives = 15/23 (65%) Frame = -3 Query: 373 LRPRSGLIDLLSSFPLKKSCRSF 305 +RP+ G + S LK++C+SF Sbjct: 35 IRPKLGKLHEASCMELKEACKSF 57 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 799,313 Number of Sequences: 2352 Number of extensions: 16619 Number of successful extensions: 45 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 44 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 45 length of database: 563,979 effective HSP length: 64 effective length of database: 413,451 effective search space used: 90132318 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -