BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_D13 (793 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicas... 24 1.2 AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. 24 1.2 AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. 24 1.2 U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 21 8.5 >AY887136-1|AAW78361.1| 580|Tribolium castaneum vasa RNA helicase protein. Length = 580 Score = 24.2 bits (50), Expect = 1.2 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +1 Query: 55 SAASAIPSLVNAFSSSKPPQTDNPSAR 135 +AA +P + N S PP T+N A+ Sbjct: 209 TAAFMLPIIHNLLSDKNPPNTENNCAQ 235 >AY884062-1|AAX84203.1| 712|Tribolium castaneum laccase 2B protein. Length = 712 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 307 SIWFRCQ*DRSTGVEKG*SNVEETVPG 227 ++W CQ + GVE+G +PG Sbjct: 147 TVWSHCQCVLADGVERGILTANRMIPG 173 >AY884061-1|AAX84202.1| 717|Tribolium castaneum laccase 2A protein. Length = 717 Score = 24.2 bits (50), Expect = 1.2 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -1 Query: 307 SIWFRCQ*DRSTGVEKG*SNVEETVPG 227 ++W CQ + GVE+G +PG Sbjct: 147 TVWSHCQCVLADGVERGILTANRMIPG 173 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 21.4 bits (43), Expect = 8.5 Identities = 10/34 (29%), Positives = 15/34 (44%) Frame = -2 Query: 714 RGGEKXXXGPFKKXGGFNPRGKSFXXGVQGFXEM 613 R GEK PF+K P + + + G E+ Sbjct: 202 RNGEKHHSFPFRKTTEIPPEPEDYVEDLVGHIEV 235 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 132,601 Number of Sequences: 336 Number of extensions: 2006 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 21480183 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -