BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_D13 (793 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) 29 4.3 SB_10219| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 10.0 >SB_24452| Best HMM Match : PKD_channel (HMM E-Value=0) Length = 1433 Score = 29.1 bits (62), Expect = 4.3 Identities = 15/39 (38%), Positives = 26/39 (66%), Gaps = 3/39 (7%) Frame = +1 Query: 277 FDLTGTETKSNSVTVQS---LPNVSSIIKGYRDAYLVNL 384 F +TG E KS+S+T++ +P V ++ +G D +LV+L Sbjct: 485 FTITGQEGKSDSITIRHADVIPRV-ALARGNEDVFLVHL 522 >SB_10219| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 929 Score = 27.9 bits (59), Expect = 10.0 Identities = 12/28 (42%), Positives = 17/28 (60%) Frame = +2 Query: 218 SDPPWDGLLNV*SSLFNACTSILLAPKP 301 ++PPW+G L S+LF+ C L KP Sbjct: 506 TNPPWEGRLFFQSNLFSWCNVFSLDRKP 533 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,958,031 Number of Sequences: 59808 Number of extensions: 304223 Number of successful extensions: 492 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 447 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 492 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2179815638 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -