BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_D13 (793 letters) Database: fruitfly 53,049 sequences; 24,988,368 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AF030155-1|AAC38985.1| 1666|Drosophila melanogaster translation ... 29 7.3 AE014135-152|AAF59403.2| 1345|Drosophila melanogaster CG10811-PA... 29 7.3 >AF030155-1|AAC38985.1| 1666|Drosophila melanogaster translation initiation factoreIF4G protein. Length = 1666 Score = 29.1 bits (62), Expect = 7.3 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +3 Query: 240 SSTFDHPFSTPVLRSYWHRNQIEQCHCAITTERLLHHKRLPR 365 S TF F PVL+ Y N+ Q C T + L+H PR Sbjct: 1572 SETFQK-FCIPVLQRYIDSNEDHQLECLYTLQLLVHGLEHPR 1612 >AE014135-152|AAF59403.2| 1345|Drosophila melanogaster CG10811-PA protein. Length = 1345 Score = 29.1 bits (62), Expect = 7.3 Identities = 16/42 (38%), Positives = 20/42 (47%) Frame = +3 Query: 240 SSTFDHPFSTPVLRSYWHRNQIEQCHCAITTERLLHHKRLPR 365 S TF F PVL+ Y N+ Q C T + L+H PR Sbjct: 1251 SETFQK-FCIPVLQRYIDSNEDHQLECLYTLQLLVHGLEHPR 1291 Database: fruitfly Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 24,988,368 Number of sequences in database: 53,049 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 27,085,761 Number of Sequences: 53049 Number of extensions: 507118 Number of successful extensions: 841 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 781 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 838 length of database: 24,988,368 effective HSP length: 84 effective length of database: 20,532,252 effective search space used: 3675273108 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -