BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_D13 (793 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U00046-6|AAN65305.1| 422|Caenorhabditis elegans Mammalian zak k... 31 1.2 U00046-5|AAC47047.4| 516|Caenorhabditis elegans Mammalian zak k... 31 1.2 AL132862-11|CAB60541.1| 396|Caenorhabditis elegans Hypothetical... 29 2.9 >U00046-6|AAN65305.1| 422|Caenorhabditis elegans Mammalian zak kinase homolog protein1, isoform b protein. Length = 422 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 231 GTVSSTFDHPFSTPVLRSYWHRNQ 302 G +++ F H S+P LR +WHR Q Sbjct: 306 GHLNNGFHHTTSSPQLRGFWHRKQ 329 >U00046-5|AAC47047.4| 516|Caenorhabditis elegans Mammalian zak kinase homolog protein1, isoform a protein. Length = 516 Score = 30.7 bits (66), Expect = 1.2 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +3 Query: 231 GTVSSTFDHPFSTPVLRSYWHRNQ 302 G +++ F H S+P LR +WHR Q Sbjct: 400 GHLNNGFHHTTSSPQLRGFWHRKQ 423 >AL132862-11|CAB60541.1| 396|Caenorhabditis elegans Hypothetical protein Y73F8A.16 protein. Length = 396 Score = 29.5 bits (63), Expect = 2.9 Identities = 14/35 (40%), Positives = 20/35 (57%) Frame = +1 Query: 262 FQRLYFDLTGTETKSNSVTVQSLPNVSSIIKGYRD 366 F L F++TG E KS V + S+ +I GYR+ Sbjct: 37 FPELNFNITGLEEKSRYVVLLSIEKYDNIRYGYRN 71 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 13,208,685 Number of Sequences: 27780 Number of extensions: 233562 Number of successful extensions: 461 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 423 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 451 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1924757034 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -