BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BmNP01_FL5_D11 (919 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.005 SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) 39 0.007 SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.007 SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.009 SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) 38 0.009 SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.011 SB_17008| Best HMM Match : Galactosyl_T (HMM E-Value=3.6e-30) 37 0.026 SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.026 SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.035 SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.046 SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.061 SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.080 SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.19 SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.24 SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) 33 0.32 SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) 33 0.32 SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.32 SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) 33 0.43 SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) 33 0.43 SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.43 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 0.49 SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.56 SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) 32 0.56 SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.75 SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) 32 0.75 SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) 31 0.99 SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) 31 0.99 SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) 31 0.99 SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) 31 0.99 SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) 31 0.99 SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) 31 0.99 SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_46412| Best HMM Match : HEAT (HMM E-Value=8) 31 0.99 SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) 31 0.99 SB_46308| Best HMM Match : IMS (HMM E-Value=0) 31 0.99 SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) 31 0.99 SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) 31 0.99 SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) 31 0.99 SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) 31 0.99 SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) 31 0.99 SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) 31 0.99 SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) 31 0.99 SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) 31 0.99 SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) 31 0.99 SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) 31 0.99 SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) 31 0.99 SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) 31 0.99 SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) 31 0.99 SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) 31 0.99 SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) 31 0.99 SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) 31 0.99 SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) 31 0.99 SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) 31 0.99 SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) 31 0.99 SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) 31 0.99 SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) 31 0.99 SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) 31 0.99 SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) 31 0.99 SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) 31 0.99 SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) 31 0.99 SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) 31 0.99 SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) 31 0.99 SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) 31 0.99 SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) 31 0.99 SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) 31 0.99 SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) 31 0.99 SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) 31 0.99 SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) 31 0.99 SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) 31 0.99 SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) 31 0.99 SB_43882| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) 31 0.99 SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) 31 0.99 SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) 31 0.99 SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) 31 0.99 SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_31775| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_31269| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_31079| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_30891| Best HMM Match : LIM (HMM E-Value=4.40008e-43) 31 0.99 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_28552| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_27244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_27230| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_26386| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_25785| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_22440| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_20758| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_20651| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_20620| Best HMM Match : zf-HIT (HMM E-Value=8.5e-10) 31 0.99 SB_20378| Best HMM Match : Adeno_E1B_19K (HMM E-Value=5.7) 31 0.99 SB_19831| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_19310| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_19077| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_16729| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_14754| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_12231| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_12047| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_11962| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_11928| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_11382| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_11225| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_9128| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_8267| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_8032| Best HMM Match : IBB (HMM E-Value=0.46) 31 0.99 SB_7769| Best HMM Match : Histone (HMM E-Value=0.2) 31 0.99 SB_7742| Best HMM Match : HEAT (HMM E-Value=9e-23) 31 0.99 SB_7402| Best HMM Match : Extensin_2 (HMM E-Value=2) 31 0.99 SB_6875| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_5394| Best HMM Match : PEGSRP (HMM E-Value=1.5) 31 0.99 SB_2918| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_1078| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_969| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.99 SB_372| Best HMM Match : CBM_2 (HMM E-Value=0.00043) 31 0.99 SB_18649| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_7849| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_15139| Best HMM Match : Collagen (HMM E-Value=0.27) 31 1.3 SB_42112| Best HMM Match : Herpes_UL49_2 (HMM E-Value=1.5) 31 1.7 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_30551| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.7 SB_59802| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_59119| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_58967| Best HMM Match : Sec23_BS (HMM E-Value=5.9) 30 2.3 SB_58852| Best HMM Match : Hormone_4 (HMM E-Value=2.8) 30 2.3 SB_58713| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_58195| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_58029| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_56603| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_56369| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_55830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_54985| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_54503| Best HMM Match : DUF753 (HMM E-Value=4.7) 30 2.3 SB_53675| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_53669| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_53077| Best HMM Match : SRP54_N (HMM E-Value=1.8) 30 2.3 SB_52837| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_51967| Best HMM Match : Wzy_C (HMM E-Value=7.3) 30 2.3 SB_50928| Best HMM Match : 7tm_2 (HMM E-Value=4.7e-07) 30 2.3 SB_50489| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_50209| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_50159| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_48895| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_48422| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_47991| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_47859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_46080| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_45570| Best HMM Match : Euplotes_phero (HMM E-Value=2.6) 30 2.3 SB_45449| Best HMM Match : Glyco_hydro_47 (HMM E-Value=1.4e-07) 30 2.3 SB_43819| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_42593| Best HMM Match : Rho_GDI (HMM E-Value=3.7e-17) 30 2.3 SB_42373| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41202| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41136| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41068| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_40980| Best HMM Match : ANF_receptor (HMM E-Value=0.00014) 30 2.3 SB_40764| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_40601| Best HMM Match : VWA_CoxE (HMM E-Value=6.3) 30 2.3 SB_40576| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_40463| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_40182| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_40003| Best HMM Match : YTV (HMM E-Value=8.9) 30 2.3 SB_39444| Best HMM Match : SAC3_GANP (HMM E-Value=0.68) 30 2.3 SB_38813| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_38774| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_38425| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_38203| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_37771| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_37596| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_36681| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_36014| Best HMM Match : DUF437 (HMM E-Value=6.4) 30 2.3 SB_35849| Best HMM Match : Fibrinogen_C (HMM E-Value=0.15) 30 2.3 SB_35317| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_35151| Best HMM Match : DUF589 (HMM E-Value=7.5) 30 2.3 SB_34685| Best HMM Match : RNA_pol_A_bac (HMM E-Value=1.8) 30 2.3 SB_34478| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_31889| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_30142| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_29043| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_28650| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_28487| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_28424| Best HMM Match : SAM_1 (HMM E-Value=8e-06) 30 2.3 SB_28245| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_27137| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_27095| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_26954| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_26672| Best HMM Match : Exo_endo_phos (HMM E-Value=0.46) 30 2.3 SB_26607| Best HMM Match : K_tetra (HMM E-Value=3.3e-08) 30 2.3 SB_25727| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 30 2.3 SB_25469| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_25193| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_24322| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_23294| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_23196| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_23195| Best HMM Match : zf-C3HC4 (HMM E-Value=1.3e-10) 30 2.3 SB_22108| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_21853| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_21523| Best HMM Match : Pkinase (HMM E-Value=9.5e-14) 30 2.3 SB_20847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_20629| Best HMM Match : WD40 (HMM E-Value=0.0014) 30 2.3 SB_18983| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_18796| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_18538| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_18411| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_18318| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_18158| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_17237| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_15818| Best HMM Match : Apo-VLDL-II (HMM E-Value=1.2) 30 2.3 SB_15375| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_14672| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_14518| Best HMM Match : MIB_HERC2 (HMM E-Value=2.4e-38) 30 2.3 SB_14044| Best HMM Match : EGF_CA (HMM E-Value=4.1e-13) 30 2.3 SB_13919| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_13475| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_13295| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_13049| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_12559| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_12016| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_11991| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_11294| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_10976| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_10247| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_9479| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_9391| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_9055| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_8565| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_8222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_8126| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_7261| Best HMM Match : RHS (HMM E-Value=5.3) 30 2.3 SB_7005| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_6339| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_6047| Best HMM Match : CXC (HMM E-Value=7.7) 30 2.3 SB_5753| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_5503| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_5427| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_4286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_4268| Best HMM Match : MtrG (HMM E-Value=1.2) 30 2.3 SB_4192| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_3720| Best HMM Match : RVT_1 (HMM E-Value=0.0031) 30 2.3 SB_3671| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_2384| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_1609| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_751| Best HMM Match : rve (HMM E-Value=7.5e-12) 30 2.3 SB_510| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_266| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_59| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_58440| Best HMM Match : Ribosomal_L9_C (HMM E-Value=0.81) 30 2.3 SB_58394| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_57506| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_57021| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_56970| Best HMM Match : Thaumatin (HMM E-Value=5.4) 30 2.3 SB_56955| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_56767| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_56729| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_56672| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_56555| Best HMM Match : 7tm_1 (HMM E-Value=4.4) 30 2.3 SB_56099| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_55954| Best HMM Match : TIL (HMM E-Value=0.74) 30 2.3 SB_55138| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_55112| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_54421| Best HMM Match : HipA_C (HMM E-Value=7.5) 30 2.3 SB_54343| Best HMM Match : TipAS (HMM E-Value=0.77) 30 2.3 SB_54153| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_54005| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_53974| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_53662| Best HMM Match : Protamine_P2 (HMM E-Value=9.2) 30 2.3 SB_53598| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_53044| Best HMM Match : TcpA (HMM E-Value=3.1) 30 2.3 SB_52956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_51739| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_51732| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_51109| Best HMM Match : ATP-cone (HMM E-Value=0.76) 30 2.3 SB_50972| Best HMM Match : MH1 (HMM E-Value=7.1) 30 2.3 SB_50818| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_50491| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_50286| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_50222| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_50081| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_50019| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_49981| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_49899| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_49895| Best HMM Match : NACHT (HMM E-Value=7.7) 30 2.3 SB_49629| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_47940| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_47474| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_47304| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_47265| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_47031| Best HMM Match : Protamine_P1 (HMM E-Value=7) 30 2.3 SB_46862| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_46484| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_46118| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_45749| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_45575| Best HMM Match : Keratin_B2 (HMM E-Value=8.8) 30 2.3 SB_45266| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_44239| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_44171| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_44073| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_43825| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_43752| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_43722| Best HMM Match : TPR_4 (HMM E-Value=0.69) 30 2.3 SB_42847| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_42555| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 30 2.3 SB_42133| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41545| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41358| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_41085| Best HMM Match : Auxin_repressed (HMM E-Value=9) 30 2.3 SB_40884| Best HMM Match : Homeobox (HMM E-Value=0.068) 30 2.3 SB_40300| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_39508| Best HMM Match : F5_F8_type_C (HMM E-Value=0) 30 2.3 SB_39208| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_38658| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_38558| Best HMM Match : TFIIA_gamma_N (HMM E-Value=7.4) 30 2.3 SB_38521| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_38282| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_38080| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_37703| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_37072| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_36830| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_36723| Best HMM Match : DUF753 (HMM E-Value=9.9) 30 2.3 SB_36604| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_36374| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_35614| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_35131| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_34873| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 SB_34844| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 2.3 >SB_46058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 39.1 bits (87), Expect = 0.005 Identities = 18/33 (54%), Positives = 20/33 (60%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL*RNLTSVV*HNWTN 630 HWPSFYNVVTGKT S+ L R +W N Sbjct: 7 HWPSFYNVVTGKTLSVTQLNRLAAHPPFASWRN 39 >SB_32211| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 109 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 526 ARHWPSFYNVVTGKTASLGSL 588 A HWPSFYNVVTGKT +L +L Sbjct: 60 AWHWPSFYNVVTGKTLALPNL 80 >SB_29113| Best HMM Match : RVT_1 (HMM E-Value=0.0066) Length = 444 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/22 (72%), Positives = 18/22 (81%) Frame = -2 Query: 588 QRSQASSFPSHDVVKRRPVPSL 523 ++ Q FPSHDVVKRRPVPSL Sbjct: 211 KQGQKGGFPSHDVVKRRPVPSL 232 >SB_28860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 44 Score = 38.7 bits (86), Expect = 0.007 Identities = 17/18 (94%), Positives = 17/18 (94%) Frame = -2 Query: 576 ASSFPSHDVVKRRPVPSL 523 AS FPSHDVVKRRPVPSL Sbjct: 11 ASVFPSHDVVKRRPVPSL 28 >SB_16375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 526 ARHWPSFYNVVTGKTASLGSL 588 A HWPSFYNVVTGKT +L +L Sbjct: 3 AWHWPSFYNVVTGKTLALPNL 23 >SB_1214| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 38.7 bits (86), Expect = 0.007 Identities = 16/21 (76%), Positives = 18/21 (85%) Frame = +1 Query: 526 ARHWPSFYNVVTGKTASLGSL 588 A HWPSFYNVVTGKT +L +L Sbjct: 55 AWHWPSFYNVVTGKTLALPNL 75 >SB_31506| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL 588 HWPSFYNVVTGKT +L +L Sbjct: 7 HWPSFYNVVTGKTLALPNL 25 >SB_25896| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL 588 HWPSFYNVVTGKT +L +L Sbjct: 7 HWPSFYNVVTGKTLALPNL 25 >SB_45641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL 588 HWPSFYNVVTGKT +L +L Sbjct: 7 HWPSFYNVVTGKTLALPNL 25 >SB_38028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL 588 HWPSFYNVVTGKT +L +L Sbjct: 7 HWPSFYNVVTGKTLALPNL 25 >SB_24487| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL 588 HWPSFYNVVTGKT +L +L Sbjct: 85 HWPSFYNVVTGKTLALPNL 103 >SB_6530| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL 588 HWPSFYNVVTGKT +L +L Sbjct: 7 HWPSFYNVVTGKTLALPNL 25 >SB_3496| Best HMM Match : Herpes_UL49_5 (HMM E-Value=7.2) Length = 98 Score = 38.3 bits (85), Expect = 0.009 Identities = 15/19 (78%), Positives = 17/19 (89%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL 588 HWPSFYNVVTGKT +L +L Sbjct: 7 HWPSFYNVVTGKTLALPNL 25 >SB_53034| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 61 Score = 37.9 bits (84), Expect = 0.011 Identities = 18/35 (51%), Positives = 20/35 (57%) Frame = +1 Query: 526 ARHWPSFYNVVTGKTASLGSL*RNLTSVV*HNWTN 630 A HWPSFYNVVTGKT + L R +W N Sbjct: 3 AWHWPSFYNVVTGKTLGVTQLNRLAAHPPFASWRN 37 >SB_17008| Best HMM Match : Galactosyl_T (HMM E-Value=3.6e-30) Length = 508 Score = 36.7 bits (81), Expect = 0.026 Identities = 18/34 (52%), Positives = 22/34 (64%) Frame = -2 Query: 624 PIMSHHRSKVPSQRSQASSFPSHDVVKRRPVPSL 523 PI + + V + +SF SHDVVKRRPVPSL Sbjct: 390 PIYNFQQQTVNFVENITNSFISHDVVKRRPVPSL 423 >SB_16994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 36.7 bits (81), Expect = 0.026 Identities = 16/18 (88%), Positives = 16/18 (88%) Frame = -2 Query: 576 ASSFPSHDVVKRRPVPSL 523 A FPSHDVVKRRPVPSL Sbjct: 11 ARVFPSHDVVKRRPVPSL 28 >SB_48986| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 36.3 bits (80), Expect = 0.035 Identities = 15/15 (100%), Positives = 15/15 (100%) Frame = -2 Query: 567 FPSHDVVKRRPVPSL 523 FPSHDVVKRRPVPSL Sbjct: 56 FPSHDVVKRRPVPSL 70 >SB_36424| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 49 Score = 35.9 bits (79), Expect = 0.046 Identities = 15/21 (71%), Positives = 17/21 (80%) Frame = +1 Query: 526 ARHWPSFYNVVTGKTASLGSL 588 A HWPSFYN VTGKT +L +L Sbjct: 3 AWHWPSFYNDVTGKTLALPNL 23 >SB_14212| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL*RNLTSVV*HNWTN 630 HWPSFYNVVTGK + L R +W N Sbjct: 7 HWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRN 39 >SB_1689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 35.9 bits (79), Expect = 0.046 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL*RNLTSVV*HNWTN 630 HWPSFYNVVTGK + L R +W N Sbjct: 7 HWPSFYNVVTGKNTGVTQLNRLAAHPPFASWRN 39 >SB_14784| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 35.5 bits (78), Expect = 0.061 Identities = 16/33 (48%), Positives = 18/33 (54%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL*RNLTSVV*HNWTN 630 HWPSFYNVVTGK + L R +W N Sbjct: 7 HWPSFYNVVTGKNPGVTQLNRLAAHPPFASWRN 39 >SB_28519| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 35.1 bits (77), Expect = 0.080 Identities = 14/19 (73%), Positives = 16/19 (84%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL 588 HW SFYNVVTGKT +L +L Sbjct: 43 HWTSFYNVVTGKTLALPNL 61 >SB_15849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 33.9 bits (74), Expect = 0.19 Identities = 21/35 (60%), Positives = 23/35 (65%), Gaps = 3/35 (8%) Frame = +3 Query: 474 AYPAFLYKVV-PIVS--RIIS*ALAVVLQRRDWEN 569 A P FL + P+ S R S ALAVVLQRRDWEN Sbjct: 4 AVPVFLMSIGDPLESTCRHASLALAVVLQRRDWEN 38 >SB_44512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 33.5 bits (73), Expect = 0.24 Identities = 18/33 (54%), Positives = 20/33 (60%) Frame = +3 Query: 471 YAYPAFLYKVVPIVSRIIS*ALAVVLQRRDWEN 569 +A P L + R S ALAVVLQRRDWEN Sbjct: 4 FAPPLLLGDPLESTCRHASLALAVVLQRRDWEN 36 >SB_14409| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 33.5 bits (73), Expect = 0.24 Identities = 12/12 (100%), Positives = 12/12 (100%) Frame = +1 Query: 532 HWPSFYNVVTGK 567 HWPSFYNVVTGK Sbjct: 7 HWPSFYNVVTGK 18 >SB_43145| Best HMM Match : PEGSRP (HMM E-Value=7.2) Length = 165 Score = 33.1 bits (72), Expect = 0.32 Identities = 21/38 (55%), Positives = 22/38 (57%) Frame = +3 Query: 456 RGAQAYAYPAFLYKVVPIVSRIIS*ALAVVLQRRDWEN 569 R A AY AF + R S ALAVVLQRRDWEN Sbjct: 59 RAAVAYCRHAF-GDPLESTCRHASLALAVVLQRRDWEN 95 >SB_33270| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 33.1 bits (72), Expect = 0.32 Identities = 25/61 (40%), Positives = 32/61 (52%), Gaps = 2/61 (3%) Frame = +3 Query: 393 YRQHNGTMCSSCRSRPL*SIPRGAQAYAYPAFLYKVVPIVS--RIIS*ALAVVLQRRDWE 566 Y GT C + +RP + G++ + K P+ S R S ALAVVLQRRDWE Sbjct: 24 YEFELGTQCCNDTARPTLT---GSRFISNKPASRKGDPLESTCRHASLALAVVLQRRDWE 80 Query: 567 N 569 N Sbjct: 81 N 81 >SB_26533| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 33.1 bits (72), Expect = 0.32 Identities = 23/63 (36%), Positives = 28/63 (44%) Frame = +3 Query: 381 ALLAYRQHNGTMCSSCRSRPL*SIPRGAQAYAYPAFLYKVVPIVSRIIS*ALAVVLQRRD 560 A +AY + + S CRSR P P + S +LAVVLQRRD Sbjct: 11 ANIAYIRQRTRVASLCRSRSNSCSPGDPLVLERPPPRWSSNSPYSESYYNSLAVVLQRRD 70 Query: 561 WEN 569 WEN Sbjct: 71 WEN 73 >SB_18654| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 392 Score = 33.1 bits (72), Expect = 0.32 Identities = 19/28 (67%), Positives = 20/28 (71%), Gaps = 2/28 (7%) Frame = +3 Query: 492 YKVVPIVS--RIIS*ALAVVLQRRDWEN 569 YK P+ S R S ALAVVLQRRDWEN Sbjct: 285 YKGDPLESTCRHASLALAVVLQRRDWEN 312 >SB_12962| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 33.1 bits (72), Expect = 0.32 Identities = 19/36 (52%), Positives = 21/36 (58%) Frame = +3 Query: 462 AQAYAYPAFLYKVVPIVSRIIS*ALAVVLQRRDWEN 569 A +Y A L + R S ALAVVLQRRDWEN Sbjct: 64 ATSYFILAILGDPLESTCRHASLALAVVLQRRDWEN 99 >SB_11176| Best HMM Match : PTS_EIIB (HMM E-Value=4.4) Length = 117 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/17 (82%), Positives = 15/17 (88%) Frame = -2 Query: 582 SQASSFPSHDVVKRRPV 532 + AS FPSHDVVKRRPV Sbjct: 34 AHASVFPSHDVVKRRPV 50 >SB_55621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 33.1 bits (72), Expect = 0.32 Identities = 14/20 (70%), Positives = 16/20 (80%) Frame = -2 Query: 591 SQRSQASSFPSHDVVKRRPV 532 + +S A FPSHDVVKRRPV Sbjct: 29 NNKSHAIVFPSHDVVKRRPV 48 >SB_31227| Best HMM Match : RIO1 (HMM E-Value=0.13) Length = 633 Score = 32.7 bits (71), Expect = 0.43 Identities = 16/24 (66%), Positives = 17/24 (70%) Frame = +3 Query: 498 VVPIVSRIIS*ALAVVLQRRDWEN 569 V+ R S ALAVVLQRRDWEN Sbjct: 432 VIKSTCRHASLALAVVLQRRDWEN 455 >SB_28922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 32.7 bits (71), Expect = 0.43 Identities = 20/38 (52%), Positives = 21/38 (55%) Frame = +3 Query: 456 RGAQAYAYPAFLYKVVPIVSRIIS*ALAVVLQRRDWEN 569 R AQ Y L + R S ALAVVLQRRDWEN Sbjct: 44 REAQRPRYVERLGDPLESTCRHASLALAVVLQRRDWEN 81 >SB_29769| Best HMM Match : TNFR_c6 (HMM E-Value=3.60001e-40) Length = 768 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 576 ASSFPSHDVVKRRPV 532 AS FPSHDVVKRRPV Sbjct: 28 ASVFPSHDVVKRRPV 42 >SB_5500| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 197 Score = 32.7 bits (71), Expect = 0.43 Identities = 14/15 (93%), Positives = 14/15 (93%) Frame = -2 Query: 576 ASSFPSHDVVKRRPV 532 AS FPSHDVVKRRPV Sbjct: 42 ASVFPSHDVVKRRPV 56 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 29.9 bits (64), Expect(2) = 0.49 Identities = 12/13 (92%), Positives = 13/13 (100%) Frame = +3 Query: 531 ALAVVLQRRDWEN 569 +LAVVLQRRDWEN Sbjct: 87 SLAVVLQRRDWEN 99 Score = 21.4 bits (43), Expect(2) = 0.49 Identities = 10/28 (35%), Positives = 15/28 (53%) Frame = +3 Query: 471 YAYPAFLYKVVPIVSRIIS*ALAVVLQR 554 Y Y LY +P++S S +VL+R Sbjct: 42 YPYIPLLYTYIPLLSNSCSPGDPLVLER 69 >SB_44604| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 32.3 bits (70), Expect = 0.56 Identities = 20/41 (48%), Positives = 23/41 (56%), Gaps = 2/41 (4%) Frame = +3 Query: 453 PRGAQAYAYPAFLYKVVPIVS--RIIS*ALAVVLQRRDWEN 569 P A Y ++ P+ S R S ALAVVLQRRDWEN Sbjct: 7 PEFPLASPYSGIVHHGDPLESTCRHASLALAVVLQRRDWEN 47 >SB_37536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 32.3 bits (70), Expect = 0.56 Identities = 26/63 (41%), Positives = 30/63 (47%), Gaps = 4/63 (6%) Frame = +3 Query: 393 YRQHNGTMCSSC-RSRPL*SIP-RGAQAYAYPAFLYKVVPIVS--RIIS*ALAVVLQRRD 560 Y GT C C R R + + G +P P+ S R S ALAVVLQRRD Sbjct: 8 YEFELGTRCCHCYRHRGVTLVVWYGFIQLRFPTIKASGDPLESTCRHASLALAVVLQRRD 67 Query: 561 WEN 569 WEN Sbjct: 68 WEN 70 >SB_15873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 185 Score = 32.3 bits (70), Expect = 0.56 Identities = 18/32 (56%), Positives = 20/32 (62%) Frame = +3 Query: 474 AYPAFLYKVVPIVSRIIS*ALAVVLQRRDWEN 569 A PA + + R S ALAVVLQRRDWEN Sbjct: 84 ARPAGVGDPLESTCRHASLALAVVLQRRDWEN 115 >SB_37492| Best HMM Match : CutA1 (HMM E-Value=2.1) Length = 197 Score = 32.3 bits (70), Expect = 0.56 Identities = 15/26 (57%), Positives = 18/26 (69%) Frame = +3 Query: 492 YKVVPIVSRIIS*ALAVVLQRRDWEN 569 Y +V + S +LAVVLQRRDWEN Sbjct: 92 YALVIVTSESYYNSLAVVLQRRDWEN 117 >SB_26639| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/14 (92%), Positives = 13/14 (92%) Frame = -2 Query: 573 SSFPSHDVVKRRPV 532 S FPSHDVVKRRPV Sbjct: 56 SGFPSHDVVKRRPV 69 >SB_17217| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 31.9 bits (69), Expect = 0.75 Identities = 13/15 (86%), Positives = 13/15 (86%) Frame = -2 Query: 576 ASSFPSHDVVKRRPV 532 A FPSHDVVKRRPV Sbjct: 34 AKGFPSHDVVKRRPV 48 >SB_49172| Best HMM Match : UCR_TM (HMM E-Value=9.8) Length = 142 Score = 31.9 bits (69), Expect = 0.75 Identities = 14/33 (42%), Positives = 17/33 (51%) Frame = +1 Query: 532 HWPSFYNVVTGKTASLGSL*RNLTSVV*HNWTN 630 HWP+FYN TGKT + L R +W N Sbjct: 50 HWPAFYNAPTGKTLAYTQLNRLAAHPPFASWRN 82 >SB_59624| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 56 RHASLALAVVLQRRDWEN 73 >SB_58723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 19 RHASLALAVVLQRRDWEN 36 >SB_58076| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 43 RHASLALAVVLQRRDWEN 60 >SB_57885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 22 RHASLALAVVLQRRDWEN 39 >SB_57829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_57692| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 84 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 23 RHASLALAVVLQRRDWEN 40 >SB_57259| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 12 RHASLALAVVLQRRDWEN 29 >SB_56880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_56660| Best HMM Match : zf-C2H2 (HMM E-Value=0) Length = 917 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 827 RHASLALAVVLQRRDWEN 844 >SB_56642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_55921| Best HMM Match : Aldo_ket_red (HMM E-Value=0.16) Length = 195 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 108 RHASLALAVVLQRRDWEN 125 >SB_55719| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 33 RHASLALAVVLQRRDWEN 50 >SB_55703| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 14 RHASLALAVVLQRRDWEN 31 >SB_55592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 31 RHASLALAVVLQRRDWEN 48 >SB_55288| Best HMM Match : TLD (HMM E-Value=0.00092) Length = 349 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 5 RHASLALAVVLQRRDWEN 22 >SB_55192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 13 RHASLALAVVLQRRDWEN 30 >SB_53462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 82 RHASLALAVVLQRRDWEN 99 >SB_53366| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 31 RHASLALAVVLQRRDWEN 48 >SB_52265| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 126 RHASLALAVVLQRRDWEN 143 >SB_52130| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 16 RHASLALAVVLQRRDWEN 33 >SB_52085| Best HMM Match : TIL (HMM E-Value=2.5) Length = 234 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 147 RHASLALAVVLQRRDWEN 164 >SB_51638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 51 RHASLALAVVLQRRDWEN 68 >SB_51529| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 15 RHASLALAVVLQRRDWEN 32 >SB_50850| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 54 RHASLALAVVLQRRDWEN 71 >SB_50473| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_49644| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1615 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 207 RHASLALAVVLQRRDWEN 224 >SB_49542| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 27 RHASLALAVVLQRRDWEN 44 >SB_49495| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 118 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 42 RHASLALAVVLQRRDWEN 59 >SB_49117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 34 RHASLALAVVLQRRDWEN 51 >SB_49064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 69 RHASLALAVVLQRRDWEN 86 >SB_48393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 16 RHASLALAVVLQRRDWEN 33 >SB_47872| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 51 RHASLALAVVLQRRDWEN 68 >SB_47732| Best HMM Match : Pkinase (HMM E-Value=0.0016) Length = 318 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 94 RHASLALAVVLQRRDWEN 111 >SB_47276| Best HMM Match : DUF851 (HMM E-Value=9.6) Length = 154 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 67 RHASLALAVVLQRRDWEN 84 >SB_46649| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 22 RHASLALAVVLQRRDWEN 39 >SB_46589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 562 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 140 RHASLALAVVLQRRDWEN 157 >SB_46412| Best HMM Match : HEAT (HMM E-Value=8) Length = 140 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 53 RHASLALAVVLQRRDWEN 70 >SB_46374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 82 RHASLALAVVLQRRDWEN 99 >SB_46344| Best HMM Match : ig (HMM E-Value=0.0082) Length = 181 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 94 RHASLALAVVLQRRDWEN 111 >SB_46308| Best HMM Match : IMS (HMM E-Value=0) Length = 1245 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 1184 RHASLALAVVLQRRDWEN 1201 >SB_46194| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 26 RHASLALAVVLQRRDWEN 43 >SB_45914| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 206 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 119 RHASLALAVVLQRRDWEN 136 >SB_45642| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 71 RHASLALAVVLQRRDWEN 88 >SB_45291| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 25 RHASLALAVVLQRRDWEN 42 >SB_44894| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_44606| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 28 RHASLALAVVLQRRDWEN 45 >SB_44358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 90 RHASLALAVVLQRRDWEN 107 >SB_43671| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 55 RHASLALAVVLQRRDWEN 72 >SB_43630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 78 RHASLALAVVLQRRDWEN 95 >SB_43569| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 95 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 34 RHASLALAVVLQRRDWEN 51 >SB_42831| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 78 RHASLALAVVLQRRDWEN 95 >SB_42725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 76 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 15 RHASLALAVVLQRRDWEN 32 >SB_42655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 59 RHASLALAVVLQRRDWEN 76 >SB_42158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 114 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 18 RHASLALAVVLQRRDWEN 35 >SB_42069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 189 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 102 RHASLALAVVLQRRDWEN 119 >SB_41806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_41728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 18 RHASLALAVVLQRRDWEN 35 >SB_41712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 198 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 37 RHASLALAVVLQRRDWEN 54 >SB_41481| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 70 RHASLALAVVLQRRDWEN 87 >SB_40939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 61 RHASLALAVVLQRRDWEN 78 >SB_40610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 172 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 85 RHASLALAVVLQRRDWEN 102 >SB_40566| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 35 RHASLALAVVLQRRDWEN 52 >SB_40462| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1580 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 1057 RHASLALAVVLQRRDWEN 1074 >SB_39942| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 121 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 85 RHASLALAVVLQRRDWEN 102 >SB_39373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 11 RHASLALAVVLQRRDWEN 28 >SB_39201| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 14 RHASLALAVVLQRRDWEN 31 >SB_38916| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 25 RHASLALAVVLQRRDWEN 42 >SB_38016| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 215 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 128 RHASLALAVVLQRRDWEN 145 >SB_37690| Best HMM Match : IgG_binding_B (HMM E-Value=4.2) Length = 263 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 176 RHASLALAVVLQRRDWEN 193 >SB_37661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 397 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 164 RHASLALAVVLQRRDWEN 181 >SB_37412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 74 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 13 RHASLALAVVLQRRDWEN 30 >SB_37245| Best HMM Match : Disintegrin (HMM E-Value=7.9) Length = 227 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 140 RHASLALAVVLQRRDWEN 157 >SB_36865| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 52 RHASLALAVVLQRRDWEN 69 >SB_35997| Best HMM Match : Phage_fiber (HMM E-Value=0.78) Length = 197 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 110 RHASLALAVVLQRRDWEN 127 >SB_35689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 93 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 17 RHASLALAVVLQRRDWEN 34 >SB_35257| Best HMM Match : Sec8_exocyst (HMM E-Value=0.59) Length = 1060 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 646 RHASLALAVVLQRRDWEN 663 >SB_34829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 33 RHASLALAVVLQRRDWEN 50 >SB_34793| Best HMM Match : TIL (HMM E-Value=4.5) Length = 242 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 155 RHASLALAVVLQRRDWEN 172 >SB_34683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 102 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 41 RHASLALAVVLQRRDWEN 58 >SB_34501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 87 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 26 RHASLALAVVLQRRDWEN 43 >SB_34403| Best HMM Match : IgG_binding_B (HMM E-Value=9.3) Length = 135 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 99 RHASLALAVVLQRRDWEN 116 >SB_34015| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 16 RHASLALAVVLQRRDWEN 33 >SB_33403| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 52 RHASLALAVVLQRRDWEN 69 >SB_32674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 11 RHASLALAVVLQRRDWEN 28 >SB_32508| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 54 RHASLALAVVLQRRDWEN 71 >SB_32411| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 65 RHASLALAVVLQRRDWEN 82 >SB_32110| Best HMM Match : PEGSRP (HMM E-Value=9.6) Length = 160 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 73 RHASLALAVVLQRRDWEN 90 >SB_31658| Best HMM Match : Arm (HMM E-Value=0.91) Length = 249 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 179 RHASLALAVVLQRRDWEN 196 >SB_31056| Best HMM Match : Virus_P-coat (HMM E-Value=6.4) Length = 154 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 67 RHASLALAVVLQRRDWEN 84 >SB_30810| Best HMM Match : JmjC (HMM E-Value=0.0021) Length = 546 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 260 RHASLALAVVLQRRDWEN 277 >SB_30786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 14 RHASLALAVVLQRRDWEN 31 >SB_30192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 28 RHASLALAVVLQRRDWEN 45 >SB_29084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 116 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 55 RHASLALAVVLQRRDWEN 72 >SB_28866| Best HMM Match : PhdYeFM (HMM E-Value=8.3) Length = 185 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 98 RHASLALAVVLQRRDWEN 115 >SB_28269| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 57 RHASLALAVVLQRRDWEN 74 >SB_27927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 67 RHASLALAVVLQRRDWEN 84 >SB_27779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 67 RHASLALAVVLQRRDWEN 84 >SB_27619| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 11 RHASLALAVVLQRRDWEN 28 >SB_27047| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 68 RHASLALAVVLQRRDWEN 85 >SB_25936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 77 RHASLALAVVLQRRDWEN 94 >SB_24859| Best HMM Match : HAP (HMM E-Value=6.4) Length = 257 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 170 RHASLALAVVLQRRDWEN 187 >SB_24787| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 112 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 25 RHASLALAVVLQRRDWEN 42 >SB_24544| Best HMM Match : PSCyt1 (HMM E-Value=4.3) Length = 164 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 77 RHASLALAVVLQRRDWEN 94 >SB_24181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 14 RHASLALAVVLQRRDWEN 31 >SB_23437| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 43 RHASLALAVVLQRRDWEN 60 >SB_22658| Best HMM Match : Protamine_3 (HMM E-Value=9.6) Length = 128 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 67 RHASLALAVVLQRRDWEN 84 >SB_22468| Best HMM Match : CUT (HMM E-Value=6.8) Length = 197 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 136 RHASLALAVVLQRRDWEN 153 >SB_22375| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 22 RHASLALAVVLQRRDWEN 39 >SB_22254| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 62 RHASLALAVVLQRRDWEN 79 >SB_21247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 51 RHASLALAVVLQRRDWEN 68 >SB_20864| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 63 RHASLALAVVLQRRDWEN 80 >SB_20839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 14 RHASLALAVVLQRRDWEN 31 >SB_20747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_19461| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 32 RHASLALAVVLQRRDWEN 49 >SB_18812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 38 RHASLALAVVLQRRDWEN 55 >SB_18436| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 94 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 33 RHASLALAVVLQRRDWEN 50 >SB_18289| Best HMM Match : IgG_binding_B (HMM E-Value=7) Length = 143 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 56 RHASLALAVVLQRRDWEN 73 >SB_17565| Best HMM Match : EGF (HMM E-Value=5.1e-05) Length = 162 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 75 RHASLALAVVLQRRDWEN 92 >SB_16725| Best HMM Match : DAGAT (HMM E-Value=1e-39) Length = 571 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 185 RHASLALAVVLQRRDWEN 202 >SB_16155| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 168 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 81 RHASLALAVVLQRRDWEN 98 >SB_15493| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 32 RHASLALAVVLQRRDWEN 49 >SB_15346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 44 RHASLALAVVLQRRDWEN 61 >SB_15295| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 119 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 43 RHASLALAVVLQRRDWEN 60 >SB_15150| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 35 RHASLALAVVLQRRDWEN 52 >SB_15134| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 16 RHASLALAVVLQRRDWEN 33 >SB_15127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 14 RHASLALAVVLQRRDWEN 31 >SB_14936| Best HMM Match : Pep_M12B_propep (HMM E-Value=9.7) Length = 207 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 120 RHASLALAVVLQRRDWEN 137 >SB_14862| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 37 RHASLALAVVLQRRDWEN 54 >SB_14045| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 63 RHASLALAVVLQRRDWEN 80 >SB_13480| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 49 RHASLALAVVLQRRDWEN 66 >SB_13372| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 12 RHASLALAVVLQRRDWEN 29 >SB_13236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 48 RHASLALAVVLQRRDWEN 65 >SB_12873| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 49 RHASLALAVVLQRRDWEN 66 >SB_12726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 52 RHASLALAVVLQRRDWEN 69 >SB_12236| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 14 RHASLALAVVLQRRDWEN 31 >SB_12187| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 88 RHASLALAVVLQRRDWEN 105 >SB_12019| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 59 RHASLALAVVLQRRDWEN 76 >SB_11632| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 248 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 161 RHASLALAVVLQRRDWEN 178 >SB_11249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 117 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 56 RHASLALAVVLQRRDWEN 73 >SB_10911| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 36 RHASLALAVVLQRRDWEN 53 >SB_10687| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 72 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 11 RHASLALAVVLQRRDWEN 28 >SB_10456| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 27 RHASLALAVVLQRRDWEN 44 >SB_10031| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 160 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 73 RHASLALAVVLQRRDWEN 90 >SB_9995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 51 RHASLALAVVLQRRDWEN 68 >SB_9697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 28 RHASLALAVVLQRRDWEN 45 >SB_9450| Best HMM Match : CM_1 (HMM E-Value=3.1) Length = 186 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 99 RHASLALAVVLQRRDWEN 116 >SB_8806| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 40 RHASLALAVVLQRRDWEN 57 >SB_8714| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 30 RHASLALAVVLQRRDWEN 47 >SB_8621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 113 RHASLALAVVLQRRDWEN 130 >SB_8582| Best HMM Match : CsgG (HMM E-Value=4.9e-06) Length = 233 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 146 RHASLALAVVLQRRDWEN 163 >SB_8530| Best HMM Match : ThiC (HMM E-Value=2.7e-07) Length = 183 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 96 RHASLALAVVLQRRDWEN 113 >SB_8498| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 115 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 28 RHASLALAVVLQRRDWEN 45 >SB_7973| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 81 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 20 RHASLALAVVLQRRDWEN 37 >SB_7142| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 49 RHASLALAVVLQRRDWEN 66 >SB_6842| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 107 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 31 RHASLALAVVLQRRDWEN 48 >SB_6464| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 50 RHASLALAVVLQRRDWEN 67 >SB_6117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 211 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 150 RHASLALAVVLQRRDWEN 167 >SB_6070| Best HMM Match : PEGSRP (HMM E-Value=3.8) Length = 82 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 21 RHASLALAVVLQRRDWEN 38 >SB_5521| Best HMM Match : SWIM (HMM E-Value=6.9) Length = 150 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 63 RHASLALAVVLQRRDWEN 80 >SB_5457| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 207 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 120 RHASLALAVVLQRRDWEN 137 >SB_4705| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 52 RHASLALAVVLQRRDWEN 69 >SB_4191| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 83 RHASLALAVVLQRRDWEN 100 >SB_4190| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 62 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 13 RHASLALAVVLQRRDWEN 30 >SB_3728| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 12 RHASLALAVVLQRRDWEN 29 >SB_3676| Best HMM Match : Cuticle_2 (HMM E-Value=3.2) Length = 322 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 20 RHASLALAVVLQRRDWEN 37 >SB_2468| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 287 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 65 RHASLALAVVLQRRDWEN 82 >SB_2230| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 79 RHASLALAVVLQRRDWEN 96 >SB_1204| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 38 RHASLALAVVLQRRDWEN 55 >SB_965| Best HMM Match : IgG_binding_B (HMM E-Value=8.5) Length = 174 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 87 RHASLALAVVLQRRDWEN 104 >SB_58985| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 229 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 133 RHASLALAVVLQRRDWEN 150 >SB_58797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 200 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 139 RHASLALAVVLQRRDWEN 156 >SB_55925| Best HMM Match : Homeobox (HMM E-Value=1e-26) Length = 1064 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 785 RHASLALAVVLQRRDWEN 802 >SB_55779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 66 RHASLALAVVLQRRDWEN 83 >SB_55121| Best HMM Match : DUF971 (HMM E-Value=8.5) Length = 174 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 87 RHASLALAVVLQRRDWEN 104 >SB_55030| Best HMM Match : Toxin_27 (HMM E-Value=1.2) Length = 110 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 49 RHASLALAVVLQRRDWEN 66 >SB_54995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 101 RHASLALAVVLQRRDWEN 118 >SB_54425| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_53532| Best HMM Match : IgG_binding_B (HMM E-Value=7.8) Length = 162 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 75 RHASLALAVVLQRRDWEN 92 >SB_52081| Best HMM Match : DUF1634 (HMM E-Value=0.55) Length = 189 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 102 RHASLALAVVLQRRDWEN 119 >SB_51954| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_51949| Best HMM Match : Toxin_14 (HMM E-Value=0.051) Length = 387 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 300 RHASLALAVVLQRRDWEN 317 >SB_51352| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 57 RHASLALAVVLQRRDWEN 74 >SB_51253| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 85 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 24 RHASLALAVVLQRRDWEN 41 >SB_49112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 46 RHASLALAVVLQRRDWEN 63 >SB_48731| Best HMM Match : zf-C3HC4 (HMM E-Value=6.5e-08) Length = 688 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 9 RHASLALAVVLQRRDWEN 26 >SB_48358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 96 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 20 RHASLALAVVLQRRDWEN 37 >SB_46185| Best HMM Match : Flt3_lig (HMM E-Value=3.3) Length = 292 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 47 RHASLALAVVLQRRDWEN 64 >SB_45537| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_45065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 50 RHASLALAVVLQRRDWEN 67 >SB_44400| Best HMM Match : AT_hook (HMM E-Value=3.3) Length = 328 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 241 RHASLALAVVLQRRDWEN 258 >SB_43882| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 86 RHASLALAVVLQRRDWEN 103 >SB_43660| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 75 RHASLALAVVLQRRDWEN 92 >SB_43339| Best HMM Match : SAC3_GANP (HMM E-Value=1.8e-09) Length = 657 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 28 RHASLALAVVLQRRDWEN 45 >SB_42664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 42 RHASLALAVVLQRRDWEN 59 >SB_42518| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 >SB_41564| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 18 RHASLALAVVLQRRDWEN 35 >SB_41244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 268 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 198 RHASLALAVVLQRRDWEN 215 >SB_40229| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 57 RHASLALAVVLQRRDWEN 74 >SB_39279| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 12 RHASLALAVVLQRRDWEN 29 >SB_36908| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 29 RHASLALAVVLQRRDWEN 46 >SB_36598| Best HMM Match : E-MAP-115 (HMM E-Value=0.092) Length = 783 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 713 RHASLALAVVLQRRDWEN 730 >SB_35835| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 33 RHASLALAVVLQRRDWEN 50 >SB_34678| Best HMM Match : Bromodomain (HMM E-Value=9e-25) Length = 1137 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 523 RHASLALAVVLQRRDWEN 540 >SB_34602| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 92 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 31 RHASLALAVVLQRRDWEN 48 >SB_33514| Best HMM Match : DUF503 (HMM E-Value=1.6) Length = 223 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 126 RHASLALAVVLQRRDWEN 143 >SB_32133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 71 Score = 31.5 bits (68), Expect = 0.99 Identities = 15/18 (83%), Positives = 15/18 (83%) Frame = +3 Query: 516 RIIS*ALAVVLQRRDWEN 569 R S ALAVVLQRRDWEN Sbjct: 10 RHASLALAVVLQRRDWEN 27 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 26,839,890 Number of Sequences: 59808 Number of extensions: 552401 Number of successful extensions: 5425 Number of sequences better than 10.0: 500 Number of HSP's better than 10.0 without gapping: 3803 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5423 length of database: 16,821,457 effective HSP length: 82 effective length of database: 11,917,201 effective search space used: 2657535823 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -